Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3ESY6

Protein Details
Accession A0A0C3ESY6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
11-31IQWDILSRRWRQRKNVQNICLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 9.5, nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MAQGRITSSGIQWDILSRRWRQRKNVQNICLLIADKIQLVGEVGPTYENCMNLQTHTHFNGGCTIRREIERLVQYLIGAGKDSQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.29
4 0.3
5 0.4
6 0.5
7 0.56
8 0.62
9 0.7
10 0.74
11 0.8
12 0.84
13 0.78
14 0.74
15 0.68
16 0.6
17 0.51
18 0.4
19 0.29
20 0.2
21 0.16
22 0.09
23 0.08
24 0.06
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.07
34 0.08
35 0.09
36 0.09
37 0.1
38 0.11
39 0.11
40 0.14
41 0.14
42 0.16
43 0.17
44 0.19
45 0.17
46 0.17
47 0.24
48 0.24
49 0.25
50 0.25
51 0.26
52 0.28
53 0.29
54 0.31
55 0.26
56 0.32
57 0.32
58 0.31
59 0.3
60 0.28
61 0.26
62 0.26
63 0.25
64 0.17
65 0.14