Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BZN9

Protein Details
Accession A0A0C3BZN9    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
60-85DVLSRRSSYHRCRKCPPQLKISGTPSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, cyto 6, nucl 3, mito 3, plas 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MIPRNYRLTLAYDDNSTAVLFSILSFLFAEACPSCFASIADQSLLFYLPGESYRWMLLHDVLSRRSSYHRCRKCPPQLKISGTPSDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.19
4 0.14
5 0.09
6 0.07
7 0.05
8 0.05
9 0.06
10 0.06
11 0.07
12 0.06
13 0.06
14 0.07
15 0.07
16 0.09
17 0.08
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.09
24 0.09
25 0.1
26 0.1
27 0.1
28 0.09
29 0.09
30 0.09
31 0.08
32 0.06
33 0.05
34 0.04
35 0.04
36 0.05
37 0.06
38 0.07
39 0.08
40 0.08
41 0.09
42 0.09
43 0.1
44 0.1
45 0.12
46 0.15
47 0.17
48 0.19
49 0.2
50 0.2
51 0.21
52 0.26
53 0.31
54 0.38
55 0.46
56 0.54
57 0.6
58 0.68
59 0.77
60 0.82
61 0.84
62 0.81
63 0.81
64 0.81
65 0.81
66 0.81
67 0.76
68 0.72