Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BW66

Protein Details
Accession A0A0C3BW66    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-103RETYPPLIRAWRRRPKIQKKBasic
NLS Segment(s)
PositionSequence
93-103AWRRRPKIQKK
Subcellular Location(s) plas 14, E.R. 5, mito 3, vacu 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALCVIMPFISTYPRSLFVSVLPKYDLIRSCVHLLCCLIFFVSIDFVGPIAGGYIVQSVGVKYVFVTASASCGVAALVGIPFLRETYPPLIRAWRRRPKIQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.21
5 0.21
6 0.29
7 0.27
8 0.27
9 0.25
10 0.24
11 0.24
12 0.28
13 0.26
14 0.21
15 0.22
16 0.23
17 0.26
18 0.27
19 0.27
20 0.23
21 0.22
22 0.19
23 0.17
24 0.14
25 0.1
26 0.07
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.02
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.04
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.09
57 0.09
58 0.07
59 0.07
60 0.06
61 0.05
62 0.05
63 0.04
64 0.03
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.06
71 0.06
72 0.1
73 0.17
74 0.2
75 0.21
76 0.23
77 0.32
78 0.4
79 0.5
80 0.57
81 0.61
82 0.66
83 0.75