Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3AJ43

Protein Details
Accession A0A0C3AJ43    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
92-113GQAPRRHPKAQHPSPHPKPENYBasic
NLS Segment(s)
PositionSequence
80-111SKRRKTARMSTGGQAPRRHPKAQHPSPHPKPE
117-122RGGNKK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLPTEPIKMRPHTHSTPPSAPLPYESLPPVALNRSVVEQAMPAAPTSACNDLLDPIPTPENVCADIHSPQPTIVDNQPPSKRRKTARMSTGGQAPRRHPKAQHPSPHPKPENYTLPRGGNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.59
4 0.58
5 0.55
6 0.48
7 0.43
8 0.36
9 0.34
10 0.27
11 0.25
12 0.23
13 0.2
14 0.19
15 0.19
16 0.18
17 0.15
18 0.15
19 0.13
20 0.13
21 0.14
22 0.14
23 0.13
24 0.11
25 0.09
26 0.09
27 0.09
28 0.09
29 0.07
30 0.07
31 0.07
32 0.08
33 0.1
34 0.11
35 0.1
36 0.1
37 0.1
38 0.11
39 0.12
40 0.11
41 0.1
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.11
53 0.12
54 0.13
55 0.13
56 0.11
57 0.12
58 0.12
59 0.14
60 0.15
61 0.19
62 0.2
63 0.27
64 0.33
65 0.37
66 0.43
67 0.47
68 0.52
69 0.52
70 0.59
71 0.62
72 0.65
73 0.69
74 0.71
75 0.67
76 0.63
77 0.66
78 0.62
79 0.58
80 0.53
81 0.5
82 0.53
83 0.55
84 0.56
85 0.52
86 0.57
87 0.62
88 0.68
89 0.72
90 0.71
91 0.76
92 0.81
93 0.88
94 0.82
95 0.76
96 0.73
97 0.71
98 0.72
99 0.67
100 0.65
101 0.6
102 0.62