Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CED2

Protein Details
Accession A0A0C3CED2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-31SIVLVKCTSRRTRHERRSVVKNSTNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, extr 3, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVKCTSRRTRHERRSVVKNSTNIHVLPFQLALPFMGNLPGVPFQIRDFVFWWEWNVVSYSYVTAFSRMGDGTVIARVKRYGYYVSQLGAIVLLPTAALNSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.47
4 0.55
5 0.66
6 0.76
7 0.81
8 0.83
9 0.82
10 0.84
11 0.83
12 0.82
13 0.77
14 0.72
15 0.64
16 0.57
17 0.52
18 0.42
19 0.36
20 0.28
21 0.22
22 0.18
23 0.15
24 0.12
25 0.1
26 0.1
27 0.08
28 0.07
29 0.07
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.07
36 0.06
37 0.07
38 0.07
39 0.07
40 0.12
41 0.12
42 0.12
43 0.12
44 0.15
45 0.15
46 0.15
47 0.16
48 0.12
49 0.12
50 0.11
51 0.11
52 0.09
53 0.08
54 0.08
55 0.07
56 0.07
57 0.09
58 0.09
59 0.09
60 0.08
61 0.08
62 0.09
63 0.09
64 0.08
65 0.07
66 0.07
67 0.07
68 0.11
69 0.12
70 0.11
71 0.12
72 0.13
73 0.14
74 0.15
75 0.17
76 0.17
77 0.18
78 0.23
79 0.23
80 0.23
81 0.23
82 0.22
83 0.19
84 0.15
85 0.13
86 0.08
87 0.06
88 0.05
89 0.04
90 0.04
91 0.04