Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BB56

Protein Details
Accession A0A0C3BB56    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-33IYDTPRPRRPLNRNNSPRRPTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 13
Family & Domain DBs
Amino Acid Sequences MVFSLNSSMRNIYDTPRPRRPLNRNNSPRRPTTYRLNPRRNPLLRHQTRLRQVRNGHAFPVGHAYEGRPSRVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.49
4 0.54
5 0.57
6 0.66
7 0.73
8 0.74
9 0.75
10 0.78
11 0.79
12 0.85
13 0.89
14 0.83
15 0.77
16 0.74
17 0.69
18 0.63
19 0.62
20 0.63
21 0.64
22 0.69
23 0.75
24 0.71
25 0.72
26 0.77
27 0.72
28 0.65
29 0.64
30 0.65
31 0.6
32 0.63
33 0.63
34 0.6
35 0.65
36 0.7
37 0.65
38 0.62
39 0.6
40 0.63
41 0.66
42 0.59
43 0.52
44 0.47
45 0.42
46 0.35
47 0.39
48 0.29
49 0.21
50 0.2
51 0.2
52 0.24
53 0.27