Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3GHU8

Protein Details
Accession A0A0C3GHU8    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
51-80HTENPEPKKKNEKRERKERNHNNNIKKEKLBasic
NLS Segment(s)
PositionSequence
56-81EPKKKNEKRERKERNHNNNIKKEKLG
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
Amino Acid Sequences MAFNQLTTHFDLVCQITSTINVFPELCQVLSSIRLNQISGSTTIPEHNKPHTENPEPKKKNEKRERKERNHNNNIKKEKLGKPLTFLTLKPDRINPTAGTCVIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.12
4 0.14
5 0.15
6 0.13
7 0.12
8 0.12
9 0.11
10 0.11
11 0.14
12 0.14
13 0.13
14 0.11
15 0.11
16 0.11
17 0.14
18 0.16
19 0.13
20 0.16
21 0.16
22 0.16
23 0.16
24 0.16
25 0.14
26 0.14
27 0.13
28 0.1
29 0.1
30 0.13
31 0.15
32 0.17
33 0.18
34 0.19
35 0.22
36 0.24
37 0.3
38 0.34
39 0.38
40 0.43
41 0.47
42 0.56
43 0.55
44 0.56
45 0.61
46 0.62
47 0.67
48 0.69
49 0.74
50 0.72
51 0.81
52 0.88
53 0.87
54 0.92
55 0.92
56 0.92
57 0.92
58 0.92
59 0.91
60 0.89
61 0.86
62 0.78
63 0.72
64 0.69
65 0.65
66 0.65
67 0.64
68 0.56
69 0.54
70 0.54
71 0.54
72 0.47
73 0.41
74 0.38
75 0.37
76 0.39
77 0.37
78 0.4
79 0.4
80 0.41
81 0.44
82 0.38
83 0.36
84 0.37