Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3FPJ2

Protein Details
Accession A0A0C3FPJ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-27IVLVRCTSRRTRRECRPVVEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRCTSRRTRRECRPVVEDSTNARTFRFQIVLPFMGNLPDVPFQIHDFVFWWEENVVSYGYITAFSRMGDDTVIARINRHGYYARRPGAIVLLPTSALNSLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.46
4 0.53
5 0.63
6 0.73
7 0.8
8 0.82
9 0.79
10 0.75
11 0.71
12 0.69
13 0.62
14 0.54
15 0.48
16 0.47
17 0.44
18 0.38
19 0.34
20 0.28
21 0.27
22 0.27
23 0.24
24 0.17
25 0.17
26 0.2
27 0.21
28 0.2
29 0.18
30 0.15
31 0.14
32 0.14
33 0.1
34 0.08
35 0.08
36 0.08
37 0.08
38 0.08
39 0.09
40 0.1
41 0.1
42 0.08
43 0.08
44 0.09
45 0.1
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.08
64 0.08
65 0.07
66 0.08
67 0.07
68 0.09
69 0.12
70 0.11
71 0.11
72 0.14
73 0.17
74 0.17
75 0.19
76 0.22
77 0.23
78 0.33
79 0.41
80 0.42
81 0.39
82 0.39
83 0.38
84 0.38
85 0.35
86 0.28
87 0.2
88 0.18
89 0.17
90 0.17
91 0.17
92 0.13