Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F2X9

Protein Details
Accession A0A0C3F2X9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-112GKETKARKPKAPKEKVAKEKKTAKGRKEKENVQSSSBasic
NLS Segment(s)
PositionSequence
78-105KETKARKPKAPKEKVAKEKKTAKGRKEK
Subcellular Location(s) nucl 15, mito_nucl 12, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAKTATATTTKAATRSANEKTKVPKEDKPKRAPSAYNLYVSQHMKPWLADNPGMKNTDAMKAIGVMWKDAPENPNQGKETKARKPKAPKEKVAKEKKTAKGRKEKENVQSSSDVEEELEEGSSEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.37
4 0.41
5 0.42
6 0.46
7 0.52
8 0.57
9 0.6
10 0.59
11 0.58
12 0.61
13 0.69
14 0.74
15 0.76
16 0.77
17 0.76
18 0.76
19 0.72
20 0.67
21 0.66
22 0.59
23 0.52
24 0.44
25 0.39
26 0.38
27 0.36
28 0.31
29 0.24
30 0.23
31 0.2
32 0.2
33 0.21
34 0.2
35 0.21
36 0.23
37 0.22
38 0.24
39 0.25
40 0.26
41 0.23
42 0.21
43 0.19
44 0.2
45 0.18
46 0.14
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.08
53 0.07
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.17
60 0.18
61 0.23
62 0.23
63 0.24
64 0.25
65 0.31
66 0.36
67 0.39
68 0.47
69 0.48
70 0.55
71 0.65
72 0.72
73 0.77
74 0.78
75 0.78
76 0.79
77 0.85
78 0.87
79 0.87
80 0.84
81 0.82
82 0.82
83 0.82
84 0.83
85 0.81
86 0.8
87 0.8
88 0.8
89 0.82
90 0.81
91 0.8
92 0.79
93 0.81
94 0.73
95 0.67
96 0.62
97 0.53
98 0.47
99 0.39
100 0.29
101 0.2
102 0.18
103 0.13
104 0.11
105 0.1