Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7AC97

Protein Details
Accession A0A0D7AC97    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-87NATQANKKWRRSKKDSASSGTHydrophilic
NLS Segment(s)
PositionSequence
73-99KKWRRSKKDSASSGTKAKRVCKGKGKE
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MSRGHAAASGTVKARTNSTERKSAVTRRTLWFGAPGTEGTPRFARGKRDVGDGNGESHNSPTSTGANATQANKKWRRSKKDSASSGTKAKRVCKGKGKEKENVPPCDGTEPAPVSSQPAPASSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.3
4 0.36
5 0.39
6 0.45
7 0.44
8 0.48
9 0.52
10 0.56
11 0.56
12 0.54
13 0.54
14 0.49
15 0.53
16 0.48
17 0.43
18 0.39
19 0.33
20 0.27
21 0.23
22 0.19
23 0.15
24 0.19
25 0.18
26 0.17
27 0.17
28 0.17
29 0.21
30 0.23
31 0.28
32 0.3
33 0.36
34 0.35
35 0.39
36 0.37
37 0.34
38 0.36
39 0.31
40 0.28
41 0.21
42 0.2
43 0.16
44 0.15
45 0.14
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.1
54 0.12
55 0.14
56 0.17
57 0.2
58 0.29
59 0.34
60 0.41
61 0.49
62 0.56
63 0.64
64 0.68
65 0.75
66 0.77
67 0.81
68 0.8
69 0.77
70 0.74
71 0.69
72 0.68
73 0.61
74 0.54
75 0.48
76 0.46
77 0.49
78 0.48
79 0.52
80 0.54
81 0.6
82 0.67
83 0.74
84 0.74
85 0.74
86 0.75
87 0.78
88 0.76
89 0.72
90 0.65
91 0.57
92 0.53
93 0.48
94 0.41
95 0.33
96 0.32
97 0.28
98 0.26
99 0.26
100 0.24
101 0.25
102 0.26
103 0.27
104 0.21