Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7A261

Protein Details
Accession A0A0D7A261    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
1-26TLNQAIRRKRKPGKRARQNSPLLHSCHydrophilic
36-55ITIRTPKKPNSAKRKVARVKHydrophilic
NLS Segment(s)
PositionSequence
7-17RRKRKPGKRAR
42-51KKPNSAKRKV
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences TLNQAIRRKRKPGKRARQNSPLLHSCPQRKGVVSQITIRTPKKPNSAKRKVARVKLTNGETTHAYIPGEGHNLQEHSVVLVTGAHVKDLPGVAYKLIRGALDLGPVTNRLTSRSRYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.92
3 0.91
4 0.91
5 0.9
6 0.85
7 0.81
8 0.76
9 0.69
10 0.65
11 0.63
12 0.59
13 0.55
14 0.53
15 0.48
16 0.43
17 0.41
18 0.44
19 0.43
20 0.39
21 0.4
22 0.39
23 0.41
24 0.45
25 0.44
26 0.41
27 0.4
28 0.43
29 0.48
30 0.53
31 0.58
32 0.64
33 0.72
34 0.75
35 0.76
36 0.81
37 0.78
38 0.77
39 0.77
40 0.7
41 0.65
42 0.62
43 0.58
44 0.5
45 0.44
46 0.37
47 0.29
48 0.26
49 0.21
50 0.16
51 0.13
52 0.09
53 0.1
54 0.09
55 0.11
56 0.09
57 0.1
58 0.1
59 0.11
60 0.11
61 0.11
62 0.1
63 0.08
64 0.08
65 0.07
66 0.06
67 0.05
68 0.05
69 0.09
70 0.09
71 0.08
72 0.08
73 0.09
74 0.1
75 0.1
76 0.11
77 0.09
78 0.1
79 0.11
80 0.12
81 0.12
82 0.12
83 0.13
84 0.12
85 0.1
86 0.13
87 0.12
88 0.14
89 0.14
90 0.13
91 0.13
92 0.15
93 0.15
94 0.15
95 0.15
96 0.16
97 0.21