Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7A4D0

Protein Details
Accession A0A0D7A4D0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-85LKVPLPGDRRRRLRRDTAARERPBasic
NLS Segment(s)
PositionSequence
71-85RRRRLRRDTAARERP
Subcellular Location(s) mito 14, cyto 8, extr 4, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MAAARGAGMAVACVSAIALSAGGMYASALDSKAKEGPSSMHKTAQWPAGSDKNMGTVEVADALKVPLPGDRRRRLRRDTAARERP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.04
16 0.05
17 0.05
18 0.07
19 0.1
20 0.1
21 0.1
22 0.1
23 0.13
24 0.19
25 0.26
26 0.26
27 0.26
28 0.26
29 0.28
30 0.3
31 0.33
32 0.26
33 0.21
34 0.23
35 0.25
36 0.25
37 0.24
38 0.22
39 0.21
40 0.2
41 0.19
42 0.16
43 0.11
44 0.1
45 0.12
46 0.12
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.1
54 0.15
55 0.23
56 0.33
57 0.42
58 0.51
59 0.61
60 0.7
61 0.74
62 0.8
63 0.82
64 0.84
65 0.85