Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7A3A7

Protein Details
Accession A0A0D7A3A7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-82ATPRRPSTPKQPSTPRRPATPKRLESPRTHydrophilic
NLS Segment(s)
PositionSequence
57-87RRPSTPKQPSTPRRPATPKRLESPRTPRRYK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences EPPDAPKDAQPCSPERPPTPSTPNYGSHSQVSGLHNSPKPFETPHQTQTPNRLATPRRPSTPKQPSTPRRPATPKRLESPRTPRRYKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.49
4 0.48
5 0.51
6 0.54
7 0.5
8 0.5
9 0.47
10 0.48
11 0.46
12 0.45
13 0.41
14 0.34
15 0.32
16 0.27
17 0.27
18 0.24
19 0.23
20 0.22
21 0.25
22 0.26
23 0.26
24 0.26
25 0.22
26 0.22
27 0.21
28 0.22
29 0.24
30 0.26
31 0.29
32 0.34
33 0.36
34 0.36
35 0.41
36 0.44
37 0.38
38 0.35
39 0.36
40 0.34
41 0.4
42 0.48
43 0.46
44 0.45
45 0.49
46 0.52
47 0.58
48 0.66
49 0.63
50 0.62
51 0.68
52 0.72
53 0.77
54 0.83
55 0.76
56 0.75
57 0.78
58 0.79
59 0.79
60 0.8
61 0.77
62 0.75
63 0.8
64 0.76
65 0.76
66 0.78
67 0.77
68 0.77