Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7AJ56

Protein Details
Accession A0A0D7AJ56    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
258-283QMSPTSRRRLRKRLHMRRKRAEKAGABasic
289-316TEKLRPGRRTKDRIRLKKLRPREYKTRTBasic
NLS Segment(s)
PositionSequence
264-314RRRLRKRLHMRRKRAEKAGAVVQLTTEKLRPGRRTKDRIRLKKLRPREYKT
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR039601  Rrn5  
Gene Ontology GO:0000500  C:RNA polymerase I upstream activating factor complex  
GO:0042790  P:nucleolar large rRNA transcription by RNA polymerase I  
Amino Acid Sequences MSKKRAFEHFLTQYRQHIQAFQDFLGSTSHSDSTASSSWSNHEKDAFFHALRLYSRWRPDLIAEHMRTRNAVEVCAYIDALDDASAQHRHADEFNLRRSMESARQMSETWVAWEEEQAQELCSVDPMWETAALLTEHHAILKAERAHIFNDESLTVDERSSTFDAWTAERLREWEQLHALESLDKYHLKVMSAMLHRAGLSEAETPAAATASTAVSAPVDRTSGLVPADREQASLGQQYSSTRTPSPGPKSQDDDLAQMSPTSRRRLRKRLHMRRKRAEKAGAVVQLTTEKLRPGRRTKDRIRLKKLRPREYKTRTSRASSEGAGAPVTGPDADTPDGEYISEPGTTKPYKIKASFAEKGVDSHTLGYLDLDLFHLTRIDYLMRSSREGQQLDKKDKTATAISYRTLQILKSIVIDFVTEAVQRAIVLRELELTLKSTKVWRMKCRDMVVSNTVRPALSTMGFFLDGPGTSDDMDGIPDDDKSSHNDDGGGENIDDDGDDDEVSVDEEDHDSNEDDDVQMSDLSDTPIKSTFREDPEDYVGIQATLTRLPDRLVQEIELDTLIEEDEDSEMEAEVMCVLQEEELLENADADADKIFETNLWEEING
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.51
4 0.45
5 0.42
6 0.43
7 0.43
8 0.36
9 0.34
10 0.29
11 0.28
12 0.26
13 0.22
14 0.17
15 0.16
16 0.17
17 0.14
18 0.15
19 0.14
20 0.18
21 0.19
22 0.21
23 0.19
24 0.2
25 0.24
26 0.31
27 0.32
28 0.29
29 0.32
30 0.3
31 0.31
32 0.37
33 0.39
34 0.32
35 0.32
36 0.31
37 0.3
38 0.31
39 0.33
40 0.33
41 0.34
42 0.39
43 0.4
44 0.4
45 0.38
46 0.41
47 0.44
48 0.45
49 0.47
50 0.45
51 0.49
52 0.5
53 0.49
54 0.46
55 0.4
56 0.39
57 0.3
58 0.28
59 0.22
60 0.2
61 0.2
62 0.2
63 0.19
64 0.11
65 0.11
66 0.1
67 0.08
68 0.07
69 0.06
70 0.06
71 0.09
72 0.11
73 0.11
74 0.13
75 0.14
76 0.16
77 0.17
78 0.22
79 0.27
80 0.32
81 0.38
82 0.4
83 0.4
84 0.38
85 0.39
86 0.39
87 0.37
88 0.39
89 0.37
90 0.34
91 0.35
92 0.35
93 0.35
94 0.33
95 0.26
96 0.2
97 0.19
98 0.18
99 0.16
100 0.17
101 0.17
102 0.14
103 0.15
104 0.13
105 0.12
106 0.12
107 0.12
108 0.11
109 0.09
110 0.09
111 0.07
112 0.07
113 0.07
114 0.08
115 0.07
116 0.07
117 0.06
118 0.09
119 0.09
120 0.08
121 0.1
122 0.1
123 0.1
124 0.1
125 0.11
126 0.09
127 0.1
128 0.16
129 0.17
130 0.19
131 0.21
132 0.22
133 0.23
134 0.25
135 0.26
136 0.2
137 0.2
138 0.16
139 0.15
140 0.15
141 0.16
142 0.14
143 0.12
144 0.12
145 0.11
146 0.15
147 0.15
148 0.14
149 0.12
150 0.14
151 0.15
152 0.16
153 0.2
154 0.18
155 0.17
156 0.17
157 0.2
158 0.21
159 0.26
160 0.26
161 0.25
162 0.25
163 0.25
164 0.26
165 0.24
166 0.2
167 0.16
168 0.15
169 0.14
170 0.14
171 0.13
172 0.12
173 0.15
174 0.16
175 0.14
176 0.16
177 0.16
178 0.21
179 0.22
180 0.23
181 0.2
182 0.19
183 0.19
184 0.18
185 0.16
186 0.09
187 0.08
188 0.09
189 0.08
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.06
206 0.06
207 0.06
208 0.07
209 0.07
210 0.09
211 0.09
212 0.11
213 0.11
214 0.12
215 0.17
216 0.16
217 0.16
218 0.14
219 0.15
220 0.15
221 0.16
222 0.14
223 0.1
224 0.11
225 0.12
226 0.15
227 0.16
228 0.16
229 0.14
230 0.16
231 0.2
232 0.27
233 0.33
234 0.36
235 0.39
236 0.4
237 0.45
238 0.44
239 0.45
240 0.39
241 0.34
242 0.28
243 0.24
244 0.2
245 0.15
246 0.15
247 0.15
248 0.17
249 0.22
250 0.27
251 0.35
252 0.44
253 0.54
254 0.61
255 0.67
256 0.75
257 0.8
258 0.86
259 0.87
260 0.89
261 0.89
262 0.92
263 0.87
264 0.83
265 0.77
266 0.67
267 0.61
268 0.55
269 0.48
270 0.37
271 0.3
272 0.24
273 0.19
274 0.17
275 0.14
276 0.09
277 0.08
278 0.12
279 0.18
280 0.24
281 0.32
282 0.41
283 0.5
284 0.58
285 0.65
286 0.71
287 0.77
288 0.8
289 0.82
290 0.82
291 0.82
292 0.82
293 0.84
294 0.84
295 0.83
296 0.8
297 0.81
298 0.78
299 0.79
300 0.78
301 0.77
302 0.7
303 0.64
304 0.6
305 0.52
306 0.47
307 0.37
308 0.31
309 0.24
310 0.21
311 0.17
312 0.14
313 0.1
314 0.08
315 0.07
316 0.05
317 0.04
318 0.03
319 0.05
320 0.06
321 0.06
322 0.07
323 0.07
324 0.07
325 0.07
326 0.07
327 0.06
328 0.07
329 0.07
330 0.07
331 0.07
332 0.12
333 0.12
334 0.14
335 0.18
336 0.23
337 0.28
338 0.29
339 0.32
340 0.34
341 0.42
342 0.43
343 0.4
344 0.38
345 0.32
346 0.31
347 0.29
348 0.24
349 0.16
350 0.14
351 0.12
352 0.1
353 0.1
354 0.09
355 0.08
356 0.06
357 0.06
358 0.06
359 0.06
360 0.05
361 0.06
362 0.06
363 0.05
364 0.06
365 0.06
366 0.07
367 0.07
368 0.09
369 0.14
370 0.15
371 0.18
372 0.2
373 0.25
374 0.31
375 0.31
376 0.34
377 0.37
378 0.44
379 0.49
380 0.49
381 0.44
382 0.39
383 0.39
384 0.38
385 0.32
386 0.28
387 0.27
388 0.27
389 0.26
390 0.28
391 0.27
392 0.26
393 0.23
394 0.2
395 0.16
396 0.15
397 0.15
398 0.14
399 0.13
400 0.12
401 0.11
402 0.11
403 0.09
404 0.08
405 0.09
406 0.07
407 0.07
408 0.07
409 0.07
410 0.06
411 0.07
412 0.07
413 0.08
414 0.08
415 0.08
416 0.09
417 0.1
418 0.11
419 0.1
420 0.12
421 0.11
422 0.11
423 0.12
424 0.14
425 0.21
426 0.28
427 0.36
428 0.43
429 0.5
430 0.58
431 0.64
432 0.65
433 0.65
434 0.59
435 0.57
436 0.55
437 0.51
438 0.44
439 0.39
440 0.35
441 0.28
442 0.26
443 0.22
444 0.17
445 0.13
446 0.12
447 0.11
448 0.11
449 0.12
450 0.12
451 0.11
452 0.1
453 0.09
454 0.1
455 0.11
456 0.1
457 0.1
458 0.1
459 0.1
460 0.09
461 0.09
462 0.07
463 0.07
464 0.07
465 0.07
466 0.08
467 0.08
468 0.09
469 0.13
470 0.18
471 0.18
472 0.18
473 0.19
474 0.19
475 0.2
476 0.21
477 0.18
478 0.13
479 0.12
480 0.12
481 0.1
482 0.09
483 0.08
484 0.07
485 0.05
486 0.05
487 0.05
488 0.06
489 0.06
490 0.07
491 0.06
492 0.06
493 0.06
494 0.07
495 0.08
496 0.08
497 0.1
498 0.1
499 0.1
500 0.11
501 0.1
502 0.09
503 0.1
504 0.1
505 0.09
506 0.08
507 0.08
508 0.08
509 0.09
510 0.11
511 0.13
512 0.12
513 0.13
514 0.18
515 0.19
516 0.19
517 0.24
518 0.29
519 0.32
520 0.39
521 0.39
522 0.39
523 0.43
524 0.43
525 0.37
526 0.31
527 0.26
528 0.19
529 0.17
530 0.14
531 0.1
532 0.11
533 0.13
534 0.12
535 0.13
536 0.14
537 0.21
538 0.23
539 0.26
540 0.26
541 0.25
542 0.26
543 0.26
544 0.25
545 0.2
546 0.16
547 0.11
548 0.1
549 0.09
550 0.06
551 0.06
552 0.05
553 0.06
554 0.06
555 0.06
556 0.06
557 0.06
558 0.07
559 0.06
560 0.06
561 0.06
562 0.05
563 0.05
564 0.05
565 0.05
566 0.05
567 0.05
568 0.06
569 0.07
570 0.08
571 0.1
572 0.1
573 0.1
574 0.09
575 0.1
576 0.09
577 0.09
578 0.08
579 0.07
580 0.07
581 0.07
582 0.08
583 0.08
584 0.12
585 0.13
586 0.15