Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D4C4

Protein Details
Accession E9D4C4   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
7-28RSTTILQPRNKPKSRRPEDDESHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MARVPGRSTTILQPRNKPKSRRPEDDESLWARTPDGEKIFRLNPTAPPPHSLTLSARIQVVPLPPAPMFGVYSTREIRQAKLSHGIQPELAALCRIDLWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.77
4 0.77
5 0.76
6 0.8
7 0.83
8 0.83
9 0.8
10 0.79
11 0.76
12 0.73
13 0.69
14 0.61
15 0.55
16 0.46
17 0.38
18 0.29
19 0.24
20 0.21
21 0.2
22 0.21
23 0.19
24 0.19
25 0.22
26 0.24
27 0.24
28 0.25
29 0.22
30 0.21
31 0.25
32 0.29
33 0.26
34 0.27
35 0.28
36 0.27
37 0.26
38 0.24
39 0.2
40 0.21
41 0.21
42 0.19
43 0.17
44 0.15
45 0.15
46 0.15
47 0.14
48 0.1
49 0.1
50 0.11
51 0.11
52 0.12
53 0.12
54 0.11
55 0.11
56 0.1
57 0.13
58 0.13
59 0.17
60 0.18
61 0.19
62 0.24
63 0.25
64 0.26
65 0.31
66 0.31
67 0.31
68 0.38
69 0.39
70 0.38
71 0.4
72 0.39
73 0.32
74 0.3
75 0.29
76 0.21
77 0.2
78 0.15
79 0.12
80 0.11