Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D6ZZ61

Protein Details
Accession A0A0D6ZZ61    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-37IEVPETLLKKRKQKEKAREERLAAAHydrophilic
NLS Segment(s)
PositionSequence
21-49KKRKQKEKAREERLAAATAARQAAKAKQK
Subcellular Location(s) cyto 17, cyto_nucl 13.333, nucl 5.5, mito_nucl 4.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR016082  Ribosomal_L30_ferredoxin-like  
IPR012988  Ribosomal_L30_N  
IPR039699  Ribosomal_L7/L30  
IPR035808  Ribosomal_L7_euk_arc  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
PF08079  Ribosomal_L30_N  
CDD cd01657  Ribosomal_L7_archeal_euk  
Amino Acid Sequences MHFPNGELVDAAIEVPETLLKKRKQKEKAREERLAAATAARQAAKAKQKVIFKRAESYVKEYIAKEREEIHLKRVARSAGDFYVPAQPKVYIRIRGINEIAPKPCKILQLLCLLQISNSVFVKVTKATQQILRPVEPYVTYGEPNLKSVRELIYKRGYGKVNKQRFPLSSNAVIKQSVSKYHILCVEDLVYEIVTAGPNFKQAANFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.08
5 0.12
6 0.21
7 0.28
8 0.37
9 0.46
10 0.56
11 0.64
12 0.74
13 0.81
14 0.84
15 0.89
16 0.89
17 0.87
18 0.81
19 0.78
20 0.69
21 0.6
22 0.49
23 0.38
24 0.3
25 0.25
26 0.23
27 0.16
28 0.14
29 0.14
30 0.21
31 0.29
32 0.32
33 0.34
34 0.37
35 0.46
36 0.52
37 0.57
38 0.57
39 0.51
40 0.53
41 0.54
42 0.55
43 0.5
44 0.49
45 0.46
46 0.41
47 0.41
48 0.36
49 0.38
50 0.35
51 0.32
52 0.27
53 0.25
54 0.27
55 0.33
56 0.33
57 0.3
58 0.32
59 0.32
60 0.33
61 0.34
62 0.3
63 0.23
64 0.23
65 0.23
66 0.18
67 0.18
68 0.16
69 0.14
70 0.21
71 0.21
72 0.19
73 0.17
74 0.17
75 0.17
76 0.23
77 0.26
78 0.22
79 0.23
80 0.29
81 0.29
82 0.31
83 0.32
84 0.28
85 0.28
86 0.26
87 0.27
88 0.22
89 0.21
90 0.2
91 0.21
92 0.2
93 0.17
94 0.16
95 0.17
96 0.22
97 0.22
98 0.22
99 0.2
100 0.18
101 0.17
102 0.17
103 0.14
104 0.1
105 0.1
106 0.09
107 0.09
108 0.09
109 0.11
110 0.1
111 0.11
112 0.12
113 0.15
114 0.16
115 0.2
116 0.23
117 0.28
118 0.31
119 0.3
120 0.27
121 0.25
122 0.24
123 0.21
124 0.19
125 0.16
126 0.14
127 0.13
128 0.13
129 0.18
130 0.18
131 0.2
132 0.2
133 0.17
134 0.16
135 0.18
136 0.21
137 0.23
138 0.24
139 0.28
140 0.34
141 0.36
142 0.38
143 0.42
144 0.43
145 0.42
146 0.51
147 0.55
148 0.58
149 0.6
150 0.62
151 0.62
152 0.59
153 0.57
154 0.52
155 0.47
156 0.46
157 0.46
158 0.44
159 0.4
160 0.38
161 0.35
162 0.35
163 0.31
164 0.28
165 0.27
166 0.3
167 0.29
168 0.33
169 0.37
170 0.32
171 0.3
172 0.27
173 0.25
174 0.19
175 0.19
176 0.16
177 0.11
178 0.1
179 0.09
180 0.08
181 0.08
182 0.08
183 0.09
184 0.09
185 0.12
186 0.13
187 0.14