Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7A6L7

Protein Details
Accession A0A0D7A6L7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-29KNGGGKGKRAPKKKSEVQKARDHMBasic
NLS Segment(s)
PositionSequence
5-21AKNGGGKGKRAPKKKSE
Subcellular Location(s) nucl 11, cyto 9, mito 5
Family & Domain DBs
Amino Acid Sequences MTQRAKNGGGKGKRAPKKKSEVQKARDHMAASVHDARQWAATITSETAEEGLVDPGVLQMVRVVQAIGRQRGFNFDDQRVSQLRVLDKDDNLTDWMGPLRKRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.72
4 0.75
5 0.78
6 0.8
7 0.81
8 0.83
9 0.81
10 0.83
11 0.78
12 0.72
13 0.66
14 0.55
15 0.45
16 0.38
17 0.31
18 0.27
19 0.26
20 0.22
21 0.21
22 0.2
23 0.2
24 0.17
25 0.16
26 0.12
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.03
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.04
51 0.05
52 0.09
53 0.14
54 0.18
55 0.18
56 0.19
57 0.19
58 0.24
59 0.26
60 0.29
61 0.29
62 0.28
63 0.31
64 0.31
65 0.35
66 0.32
67 0.33
68 0.28
69 0.27
70 0.29
71 0.27
72 0.32
73 0.32
74 0.3
75 0.32
76 0.3
77 0.28
78 0.25
79 0.23
80 0.18
81 0.15
82 0.19
83 0.2
84 0.24