Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7A6A1

Protein Details
Accession A0A0D7A6A1   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-48SVDAKEKKRFSKSKKHKRTEHAVETSSHydrophilic
NLS Segment(s)
PositionSequence
26-40KEKKRFSKSKKHKRT
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MSEIDDIFSGKGFPTPVAPALSVDAKEKKRFSKSKKHKRTEHAVETSSKKAKSTVQTIVDTSDIVKKPKAHNSAKTPSHKPSTLKKNSKPPTGDDQATFRDSRGTGPRRKTEEGWSIYKEDELGIGNEGGDTPLCPFDCQCCECLVEFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.18
5 0.18
6 0.17
7 0.19
8 0.2
9 0.19
10 0.21
11 0.26
12 0.29
13 0.35
14 0.39
15 0.43
16 0.51
17 0.6
18 0.64
19 0.68
20 0.74
21 0.8
22 0.86
23 0.89
24 0.88
25 0.87
26 0.89
27 0.88
28 0.86
29 0.8
30 0.72
31 0.67
32 0.61
33 0.59
34 0.53
35 0.43
36 0.34
37 0.3
38 0.33
39 0.33
40 0.35
41 0.35
42 0.35
43 0.36
44 0.36
45 0.35
46 0.3
47 0.24
48 0.19
49 0.19
50 0.16
51 0.16
52 0.18
53 0.21
54 0.25
55 0.33
56 0.41
57 0.4
58 0.45
59 0.52
60 0.58
61 0.61
62 0.62
63 0.58
64 0.54
65 0.54
66 0.5
67 0.46
68 0.47
69 0.5
70 0.55
71 0.6
72 0.62
73 0.68
74 0.71
75 0.75
76 0.68
77 0.62
78 0.59
79 0.56
80 0.51
81 0.42
82 0.39
83 0.35
84 0.35
85 0.3
86 0.22
87 0.2
88 0.18
89 0.21
90 0.27
91 0.32
92 0.37
93 0.44
94 0.52
95 0.56
96 0.6
97 0.58
98 0.56
99 0.58
100 0.56
101 0.53
102 0.48
103 0.43
104 0.39
105 0.37
106 0.29
107 0.2
108 0.16
109 0.12
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.07
118 0.06
119 0.07
120 0.1
121 0.11
122 0.12
123 0.13
124 0.18
125 0.25
126 0.26
127 0.26
128 0.24
129 0.26