Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7A3N9

Protein Details
Accession A0A0D7A3N9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
58-80NTLAARKSRARRRDKQEQIEAKNHydrophilic
NLS Segment(s)
PositionSequence
63-70RKSRARRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences LPLNAPIQSRNYVTESVTSRKPLPQSYLNKRRQRDVSVDSTSVSQATLDQIEANRRANTLAARKSRARRRDKQEQIEAKNEELDRLVNLWRTRASTLRQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.3
4 0.31
5 0.31
6 0.3
7 0.33
8 0.36
9 0.34
10 0.36
11 0.4
12 0.47
13 0.55
14 0.64
15 0.69
16 0.73
17 0.72
18 0.73
19 0.7
20 0.64
21 0.6
22 0.55
23 0.52
24 0.48
25 0.46
26 0.39
27 0.34
28 0.29
29 0.22
30 0.16
31 0.09
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.06
38 0.09
39 0.11
40 0.13
41 0.13
42 0.13
43 0.13
44 0.13
45 0.17
46 0.2
47 0.26
48 0.28
49 0.32
50 0.38
51 0.47
52 0.55
53 0.61
54 0.64
55 0.67
56 0.72
57 0.78
58 0.83
59 0.83
60 0.84
61 0.84
62 0.79
63 0.77
64 0.7
65 0.6
66 0.55
67 0.45
68 0.36
69 0.27
70 0.23
71 0.16
72 0.15
73 0.17
74 0.18
75 0.19
76 0.22
77 0.23
78 0.25
79 0.28
80 0.31
81 0.34