Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7ALV2

Protein Details
Accession A0A0D7ALV2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MQNFPWPHRQQQQQPPQPTAHydrophilic
457-499QEDDEGERRRRKERERRDRREERRQRRAEKDREREKRQQSAHGBasic
NLS Segment(s)
PositionSequence
464-494RRRRKERERRDRREERRQRRAEKDREREKRQ
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 9, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MQNFPWPHRQQQQQPPQPTAWAQPPPWALQQMHQQQQQQPPAWGQQRQQQQQQQAPYGFNGQQPPAPFVTPGWNHRPLANGGNPVIPSQYDPRKVKEAELLQRIPIEDTLAPDAAAARRKISTSRHRQHLSAPPPATAAAAAVSSMTAPFKSALKARRILFDDHGDTHHRQVSRIRRGSNAAPKGGGFILDDDGKSFDAVYLFLTFLGEDTLRLENAPEPALTELNELLPDFWPYHAVMSPVGGQVSSDSTFTYHIKFSNCPWRVSNRADRIETWDLIIKIFQLFIRRGYACEQAMNLSDMSPRIPLAIAFPIGEPQVFLGFFSNKDTRLTLVRPPRRVEEDLGWMLKERLMGNLSSDQEQEGGIYRIFDIKTNTAGQPCVDPPHFMMHVLTALRHLGYKHEVCVPLVEGNNMFRKARRDVMVFRVVSDVTLLDEEKLRVVDAGPAEDAAAQDAGYQEDDEGERRRRKERERRDRREERRQRRAEKDREREKRQQSAHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.71
4 0.66
5 0.58
6 0.53
7 0.5
8 0.47
9 0.41
10 0.43
11 0.45
12 0.44
13 0.46
14 0.45
15 0.38
16 0.37
17 0.46
18 0.48
19 0.53
20 0.55
21 0.57
22 0.58
23 0.66
24 0.69
25 0.62
26 0.55
27 0.51
28 0.55
29 0.56
30 0.54
31 0.49
32 0.49
33 0.56
34 0.6
35 0.66
36 0.64
37 0.66
38 0.67
39 0.69
40 0.69
41 0.61
42 0.55
43 0.48
44 0.46
45 0.4
46 0.37
47 0.35
48 0.3
49 0.29
50 0.29
51 0.31
52 0.28
53 0.26
54 0.22
55 0.2
56 0.27
57 0.29
58 0.34
59 0.38
60 0.41
61 0.41
62 0.42
63 0.45
64 0.39
65 0.41
66 0.39
67 0.36
68 0.31
69 0.33
70 0.32
71 0.29
72 0.26
73 0.19
74 0.18
75 0.21
76 0.28
77 0.34
78 0.37
79 0.41
80 0.48
81 0.49
82 0.49
83 0.49
84 0.5
85 0.5
86 0.55
87 0.51
88 0.45
89 0.45
90 0.43
91 0.36
92 0.27
93 0.21
94 0.14
95 0.15
96 0.16
97 0.15
98 0.14
99 0.13
100 0.14
101 0.14
102 0.19
103 0.17
104 0.16
105 0.17
106 0.19
107 0.24
108 0.31
109 0.39
110 0.45
111 0.54
112 0.62
113 0.63
114 0.63
115 0.67
116 0.67
117 0.63
118 0.6
119 0.52
120 0.43
121 0.41
122 0.4
123 0.32
124 0.22
125 0.16
126 0.07
127 0.06
128 0.06
129 0.05
130 0.04
131 0.04
132 0.05
133 0.05
134 0.04
135 0.05
136 0.06
137 0.08
138 0.1
139 0.16
140 0.22
141 0.27
142 0.34
143 0.34
144 0.4
145 0.42
146 0.42
147 0.4
148 0.39
149 0.36
150 0.31
151 0.33
152 0.31
153 0.29
154 0.29
155 0.29
156 0.25
157 0.23
158 0.29
159 0.37
160 0.44
161 0.48
162 0.46
163 0.45
164 0.49
165 0.55
166 0.57
167 0.51
168 0.42
169 0.36
170 0.34
171 0.33
172 0.29
173 0.22
174 0.12
175 0.09
176 0.09
177 0.1
178 0.09
179 0.08
180 0.09
181 0.09
182 0.08
183 0.07
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.05
193 0.05
194 0.06
195 0.05
196 0.04
197 0.06
198 0.07
199 0.07
200 0.07
201 0.08
202 0.08
203 0.09
204 0.1
205 0.08
206 0.08
207 0.09
208 0.09
209 0.09
210 0.08
211 0.07
212 0.07
213 0.07
214 0.07
215 0.06
216 0.06
217 0.07
218 0.06
219 0.06
220 0.07
221 0.07
222 0.08
223 0.08
224 0.09
225 0.08
226 0.08
227 0.09
228 0.08
229 0.08
230 0.06
231 0.06
232 0.05
233 0.07
234 0.07
235 0.06
236 0.06
237 0.06
238 0.08
239 0.09
240 0.11
241 0.1
242 0.12
243 0.13
244 0.15
245 0.18
246 0.27
247 0.28
248 0.29
249 0.3
250 0.33
251 0.36
252 0.41
253 0.46
254 0.44
255 0.45
256 0.45
257 0.43
258 0.46
259 0.43
260 0.37
261 0.29
262 0.25
263 0.21
264 0.19
265 0.19
266 0.12
267 0.09
268 0.09
269 0.09
270 0.1
271 0.1
272 0.12
273 0.16
274 0.16
275 0.17
276 0.19
277 0.23
278 0.19
279 0.19
280 0.18
281 0.15
282 0.16
283 0.15
284 0.12
285 0.09
286 0.09
287 0.09
288 0.09
289 0.08
290 0.07
291 0.06
292 0.06
293 0.06
294 0.07
295 0.09
296 0.08
297 0.08
298 0.09
299 0.09
300 0.09
301 0.09
302 0.07
303 0.06
304 0.07
305 0.06
306 0.06
307 0.08
308 0.08
309 0.09
310 0.14
311 0.15
312 0.15
313 0.17
314 0.17
315 0.16
316 0.19
317 0.21
318 0.24
319 0.33
320 0.39
321 0.43
322 0.46
323 0.49
324 0.51
325 0.51
326 0.47
327 0.4
328 0.4
329 0.38
330 0.36
331 0.31
332 0.26
333 0.23
334 0.21
335 0.19
336 0.13
337 0.12
338 0.13
339 0.13
340 0.15
341 0.19
342 0.2
343 0.19
344 0.19
345 0.16
346 0.15
347 0.15
348 0.13
349 0.1
350 0.1
351 0.09
352 0.09
353 0.09
354 0.13
355 0.13
356 0.15
357 0.16
358 0.16
359 0.19
360 0.22
361 0.24
362 0.21
363 0.22
364 0.2
365 0.2
366 0.2
367 0.23
368 0.21
369 0.2
370 0.2
371 0.25
372 0.25
373 0.22
374 0.21
375 0.16
376 0.18
377 0.17
378 0.16
379 0.11
380 0.12
381 0.11
382 0.12
383 0.12
384 0.12
385 0.19
386 0.2
387 0.21
388 0.27
389 0.27
390 0.26
391 0.28
392 0.26
393 0.23
394 0.23
395 0.22
396 0.17
397 0.2
398 0.25
399 0.26
400 0.25
401 0.24
402 0.29
403 0.32
404 0.38
405 0.39
406 0.39
407 0.42
408 0.49
409 0.55
410 0.49
411 0.45
412 0.41
413 0.35
414 0.29
415 0.25
416 0.17
417 0.1
418 0.11
419 0.1
420 0.09
421 0.12
422 0.12
423 0.13
424 0.13
425 0.12
426 0.11
427 0.11
428 0.15
429 0.13
430 0.15
431 0.14
432 0.14
433 0.14
434 0.14
435 0.13
436 0.1
437 0.09
438 0.07
439 0.07
440 0.08
441 0.09
442 0.09
443 0.09
444 0.08
445 0.09
446 0.11
447 0.14
448 0.2
449 0.29
450 0.35
451 0.4
452 0.49
453 0.56
454 0.66
455 0.74
456 0.79
457 0.81
458 0.85
459 0.91
460 0.93
461 0.95
462 0.94
463 0.94
464 0.94
465 0.94
466 0.93
467 0.93
468 0.92
469 0.92
470 0.93
471 0.93
472 0.92
473 0.92
474 0.92
475 0.92
476 0.91
477 0.91
478 0.89
479 0.88