Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7ALC2

Protein Details
Accession A0A0D7ALC2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
3-46VTIPIVKKRTKVFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
10-19KRTKVFKRHQ
22-49RYHSVKESWRKPKGIDNRVRRRFKGQTP
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVTIPIVKKRTKVFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGQTPMPKIGYGSNKKTRHVLPNHLKKFLVSNVRELDLLLIHSGSFAAEIAHNVSSRNRITILDRAKVLGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.83
4 0.87
5 0.87
6 0.86
7 0.84
8 0.83
9 0.79
10 0.73
11 0.64
12 0.6
13 0.61
14 0.6
15 0.62
16 0.64
17 0.62
18 0.6
19 0.61
20 0.65
21 0.66
22 0.67
23 0.67
24 0.68
25 0.72
26 0.8
27 0.84
28 0.77
29 0.75
30 0.71
31 0.69
32 0.69
33 0.66
34 0.67
35 0.68
36 0.71
37 0.64
38 0.58
39 0.51
40 0.45
41 0.45
42 0.4
43 0.4
44 0.44
45 0.45
46 0.45
47 0.49
48 0.48
49 0.48
50 0.46
51 0.49
52 0.5
53 0.58
54 0.6
55 0.58
56 0.54
57 0.45
58 0.43
59 0.39
60 0.37
61 0.27
62 0.29
63 0.29
64 0.3
65 0.29
66 0.26
67 0.21
68 0.13
69 0.12
70 0.08
71 0.06
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.03
78 0.04
79 0.04
80 0.05
81 0.07
82 0.08
83 0.08
84 0.09
85 0.11
86 0.16
87 0.16
88 0.18
89 0.17
90 0.17
91 0.21
92 0.29
93 0.33
94 0.32
95 0.32
96 0.31
97 0.32
98 0.31
99 0.28
100 0.25
101 0.2
102 0.18
103 0.22
104 0.26
105 0.27
106 0.27
107 0.31
108 0.28