Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AIV1

Protein Details
Accession A0A0D7AIV1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-34TQSCLNCHTSKRKCDRKRPCHRCIQLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences KRRRNRTTQSCLNCHTSKRKCDRKRPCHRCIQLGLTGLCVYEVDDPSLRDDPTIDERTRLRNRIAELESLVRELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.61
4 0.63
5 0.67
6 0.73
7 0.76
8 0.83
9 0.88
10 0.89
11 0.92
12 0.92
13 0.89
14 0.89
15 0.83
16 0.78
17 0.72
18 0.65
19 0.57
20 0.5
21 0.43
22 0.33
23 0.28
24 0.21
25 0.16
26 0.12
27 0.08
28 0.07
29 0.07
30 0.08
31 0.09
32 0.09
33 0.13
34 0.15
35 0.14
36 0.12
37 0.12
38 0.14
39 0.21
40 0.26
41 0.23
42 0.24
43 0.27
44 0.37
45 0.43
46 0.43
47 0.4
48 0.4
49 0.43
50 0.48
51 0.49
52 0.42
53 0.38
54 0.39
55 0.36