Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AH12

Protein Details
Accession A0A0D7AH12    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
192-229AGKVKSQTPKVDKQEKKKVPKGRAKKRLLYNRRFVNVTHydrophilic
NLS Segment(s)
PositionSequence
191-219RAGKVKSQTPKVDKQEKKKVPKGRAKKRL
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR006846  Ribosomal_S30  
IPR001163  Sm_dom_euk/arc  
IPR016654  U6_snRNA_Lsm2  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006397  P:mRNA processing  
GO:0006364  P:rRNA processing  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01423  LSM  
PF04758  Ribosomal_S30  
CDD cd01725  LSm2  
Amino Acid Sequences MPGTDIQTPNIRPELHERVYMIEEKKLGLLSGNLQAFHAEKDMIQSTGFKNPINRELTWPSRGDSAACIQSTPWSFSRVAMVNILFSPALSLPNSLQLIFSVFKTLTDQEVTVELKNDLSITGVLKSVDQFLNIRLDNIKVLDETRHPHMARLLTSLLTLGKLTHLGLPVDHVDTQLLEDATRRVHGSLARAGKVKSQTPKVDKQEKKKVPKGRAKKRLLYNRRFVNVTTHTGKRRMNPNPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.41
4 0.37
5 0.35
6 0.39
7 0.42
8 0.35
9 0.3
10 0.27
11 0.25
12 0.26
13 0.22
14 0.19
15 0.14
16 0.14
17 0.13
18 0.19
19 0.2
20 0.19
21 0.18
22 0.19
23 0.19
24 0.19
25 0.17
26 0.11
27 0.09
28 0.13
29 0.15
30 0.14
31 0.14
32 0.16
33 0.16
34 0.23
35 0.25
36 0.22
37 0.26
38 0.29
39 0.37
40 0.38
41 0.37
42 0.36
43 0.42
44 0.45
45 0.44
46 0.41
47 0.34
48 0.32
49 0.32
50 0.26
51 0.21
52 0.21
53 0.21
54 0.2
55 0.18
56 0.16
57 0.2
58 0.21
59 0.22
60 0.19
61 0.18
62 0.19
63 0.19
64 0.24
65 0.21
66 0.2
67 0.18
68 0.17
69 0.15
70 0.15
71 0.15
72 0.1
73 0.08
74 0.08
75 0.06
76 0.08
77 0.07
78 0.08
79 0.07
80 0.12
81 0.13
82 0.12
83 0.11
84 0.1
85 0.12
86 0.12
87 0.12
88 0.09
89 0.09
90 0.09
91 0.11
92 0.11
93 0.1
94 0.1
95 0.1
96 0.09
97 0.11
98 0.12
99 0.1
100 0.11
101 0.09
102 0.09
103 0.09
104 0.08
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.07
114 0.09
115 0.08
116 0.08
117 0.08
118 0.09
119 0.13
120 0.13
121 0.14
122 0.12
123 0.12
124 0.12
125 0.12
126 0.11
127 0.07
128 0.08
129 0.09
130 0.11
131 0.13
132 0.16
133 0.22
134 0.22
135 0.23
136 0.26
137 0.26
138 0.25
139 0.25
140 0.21
141 0.15
142 0.15
143 0.15
144 0.11
145 0.09
146 0.09
147 0.06
148 0.06
149 0.06
150 0.07
151 0.08
152 0.09
153 0.09
154 0.09
155 0.11
156 0.12
157 0.13
158 0.12
159 0.1
160 0.09
161 0.09
162 0.1
163 0.1
164 0.09
165 0.07
166 0.08
167 0.09
168 0.1
169 0.11
170 0.11
171 0.09
172 0.12
173 0.14
174 0.17
175 0.23
176 0.27
177 0.28
178 0.3
179 0.3
180 0.33
181 0.36
182 0.38
183 0.39
184 0.43
185 0.49
186 0.54
187 0.63
188 0.67
189 0.73
190 0.75
191 0.78
192 0.81
193 0.82
194 0.85
195 0.84
196 0.84
197 0.84
198 0.87
199 0.88
200 0.88
201 0.89
202 0.88
203 0.88
204 0.89
205 0.9
206 0.9
207 0.88
208 0.87
209 0.85
210 0.81
211 0.73
212 0.64
213 0.61
214 0.56
215 0.54
216 0.5
217 0.48
218 0.49
219 0.54
220 0.57
221 0.56
222 0.61
223 0.63