Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7AFE2

Protein Details
Accession A0A0D7AFE2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-20RLNKNKKLVKKLAKKFRVLSHydrophilic
NLS Segment(s)
PositionSequence
7-7K
9-13VKKLA
Subcellular Location(s) mito 17.5, cyto_mito 10.5, extr 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
Amino Acid Sequences RLNKNKKLVKKLAKKFRVLSAQALIFGASAGKFPTPVSHTEDLSNKITEVRSTIKFQLKKVLLHSAIAYSWTHCPDDRRSPCSATPSINFLVSLLKKNWQNVKSLHIKTTMGKPVRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.79
3 0.76
4 0.75
5 0.66
6 0.6
7 0.54
8 0.47
9 0.4
10 0.36
11 0.28
12 0.18
13 0.15
14 0.11
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.1
22 0.12
23 0.14
24 0.21
25 0.22
26 0.23
27 0.26
28 0.28
29 0.28
30 0.28
31 0.26
32 0.19
33 0.19
34 0.18
35 0.15
36 0.15
37 0.16
38 0.16
39 0.19
40 0.24
41 0.29
42 0.31
43 0.32
44 0.38
45 0.36
46 0.35
47 0.34
48 0.35
49 0.29
50 0.27
51 0.27
52 0.19
53 0.16
54 0.16
55 0.14
56 0.09
57 0.1
58 0.11
59 0.12
60 0.12
61 0.16
62 0.21
63 0.32
64 0.35
65 0.38
66 0.39
67 0.42
68 0.43
69 0.46
70 0.42
71 0.35
72 0.32
73 0.32
74 0.3
75 0.27
76 0.24
77 0.19
78 0.23
79 0.21
80 0.23
81 0.2
82 0.25
83 0.28
84 0.34
85 0.43
86 0.38
87 0.42
88 0.4
89 0.47
90 0.51
91 0.51
92 0.48
93 0.42
94 0.43
95 0.41
96 0.47
97 0.49
98 0.43