Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AR13

Protein Details
Accession A0A0D7AR13   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRQRRSRMHHARRDVHRASRBasic
75-100ALESHWKSKVHKRRCKQLREKVYTVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGRQRRSRMHHARRDVHRASRSRAFPLRTIDQIQLIDLDPKVRKALESQSLDFDKPGLAQHYCVECAHYYETNHALESHWKSKVHKRRCKQLREKVYTVEDAEAAGGAGRETR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.81
3 0.79
4 0.77
5 0.72
6 0.68
7 0.67
8 0.62
9 0.6
10 0.6
11 0.54
12 0.5
13 0.52
14 0.49
15 0.44
16 0.44
17 0.37
18 0.34
19 0.31
20 0.26
21 0.21
22 0.17
23 0.15
24 0.12
25 0.15
26 0.12
27 0.13
28 0.14
29 0.13
30 0.13
31 0.14
32 0.2
33 0.24
34 0.28
35 0.28
36 0.31
37 0.32
38 0.32
39 0.29
40 0.23
41 0.14
42 0.11
43 0.11
44 0.09
45 0.08
46 0.09
47 0.11
48 0.12
49 0.13
50 0.13
51 0.14
52 0.12
53 0.13
54 0.15
55 0.14
56 0.14
57 0.15
58 0.18
59 0.17
60 0.17
61 0.16
62 0.14
63 0.19
64 0.24
65 0.26
66 0.27
67 0.29
68 0.33
69 0.43
70 0.53
71 0.57
72 0.62
73 0.66
74 0.73
75 0.81
76 0.88
77 0.89
78 0.89
79 0.89
80 0.88
81 0.83
82 0.78
83 0.72
84 0.64
85 0.55
86 0.45
87 0.34
88 0.25
89 0.22
90 0.15
91 0.11
92 0.08
93 0.06