Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7A068

Protein Details
Accession A0A0D7A068    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-29SAATRRQYLLNRPRKKRLKMLGYRRSLEHydrophilic
NLS Segment(s)
PositionSequence
14-18PRKKR
Subcellular Location(s) mito 21, cyto_mito 12.833, mito_nucl 12.333, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017998  Chaperone_TCP-1  
IPR027413  GROEL-like_equatorial_sf  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140662  F:ATP-dependent protein folding chaperone  
Amino Acid Sequences MSAATRRQYLLNRPRKKRLKMLGYRRSLEVGDLVKSTMGPKGMNEILQCASALDNAATKILVNIPRVQDDKPGNGTTTFTTVLASFGSEHWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.84
4 0.84
5 0.83
6 0.83
7 0.83
8 0.87
9 0.86
10 0.83
11 0.77
12 0.68
13 0.6
14 0.49
15 0.39
16 0.31
17 0.23
18 0.17
19 0.15
20 0.13
21 0.11
22 0.11
23 0.11
24 0.09
25 0.09
26 0.08
27 0.07
28 0.12
29 0.12
30 0.13
31 0.13
32 0.13
33 0.13
34 0.13
35 0.12
36 0.08
37 0.08
38 0.06
39 0.07
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.09
48 0.12
49 0.13
50 0.17
51 0.18
52 0.23
53 0.24
54 0.25
55 0.28
56 0.28
57 0.3
58 0.32
59 0.32
60 0.29
61 0.28
62 0.29
63 0.24
64 0.24
65 0.21
66 0.16
67 0.15
68 0.14
69 0.14
70 0.13
71 0.12
72 0.09