Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DFR5

Protein Details
Accession E9DFR5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
129-148YLEVMRKVKRAKRRVETEDDHydrophilic
NLS Segment(s)
PositionSequence
137-140KRAK
Subcellular Location(s) plas 16, cyto 4, nucl 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038882  Rcf3  
Amino Acid Sequences MPPPSKLRADVEPPDQVTDEGIKGFLTGAVRFGSLSIIAHLILILPHPMHFADHTPAPPSPSSASSSPFRGRRPINLASVYRPLMSISESIAPISRVYRGLTPQFKVFLQISAMTFGGCIWAEKRVQEYLEVMRKVKRAKRRVETEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.33
4 0.28
5 0.24
6 0.19
7 0.14
8 0.13
9 0.1
10 0.1
11 0.1
12 0.1
13 0.09
14 0.09
15 0.1
16 0.1
17 0.1
18 0.1
19 0.1
20 0.09
21 0.08
22 0.08
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.07
37 0.08
38 0.09
39 0.11
40 0.13
41 0.14
42 0.15
43 0.15
44 0.17
45 0.16
46 0.16
47 0.15
48 0.15
49 0.18
50 0.16
51 0.19
52 0.19
53 0.23
54 0.26
55 0.28
56 0.28
57 0.31
58 0.31
59 0.33
60 0.37
61 0.36
62 0.35
63 0.35
64 0.35
65 0.31
66 0.33
67 0.28
68 0.22
69 0.19
70 0.15
71 0.12
72 0.12
73 0.1
74 0.08
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.1
85 0.12
86 0.16
87 0.23
88 0.27
89 0.28
90 0.29
91 0.3
92 0.28
93 0.3
94 0.26
95 0.2
96 0.17
97 0.17
98 0.16
99 0.16
100 0.16
101 0.12
102 0.11
103 0.1
104 0.1
105 0.08
106 0.08
107 0.07
108 0.11
109 0.12
110 0.14
111 0.17
112 0.18
113 0.18
114 0.19
115 0.22
116 0.26
117 0.34
118 0.35
119 0.34
120 0.36
121 0.41
122 0.48
123 0.52
124 0.55
125 0.56
126 0.64
127 0.73
128 0.78