Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7AQM9

Protein Details
Accession A0A0D7AQM9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-24RVTLRKRQPYNTTSNRRRVVKHydrophilic
NLS Segment(s)
PositionSequence
107-113SQPKARK
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTLRKRQPYNTTSNRRRVVKTPGGKLVYHHLKKLATAPKCGDCGIALPGIPALRPRQYATISKRQKTVRRPYGGSRCGDCVKTRIMRAFLVEEAKIVKRVLKSQPKARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.79
4 0.81
5 0.8
6 0.76
7 0.74
8 0.69
9 0.68
10 0.67
11 0.66
12 0.63
13 0.63
14 0.6
15 0.56
16 0.52
17 0.52
18 0.52
19 0.46
20 0.41
21 0.36
22 0.34
23 0.34
24 0.41
25 0.39
26 0.31
27 0.33
28 0.35
29 0.34
30 0.35
31 0.34
32 0.27
33 0.19
34 0.17
35 0.14
36 0.12
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.08
44 0.1
45 0.11
46 0.12
47 0.15
48 0.18
49 0.25
50 0.3
51 0.39
52 0.45
53 0.46
54 0.51
55 0.55
56 0.6
57 0.62
58 0.67
59 0.66
60 0.65
61 0.67
62 0.7
63 0.73
64 0.71
65 0.64
66 0.55
67 0.5
68 0.46
69 0.45
70 0.37
71 0.29
72 0.31
73 0.32
74 0.34
75 0.34
76 0.34
77 0.33
78 0.34
79 0.34
80 0.29
81 0.28
82 0.24
83 0.2
84 0.2
85 0.21
86 0.21
87 0.19
88 0.2
89 0.21
90 0.28
91 0.37
92 0.45
93 0.52