Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D877

Protein Details
Accession E9D877   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
265-293LRDSMHRRDSRRQSRSRNSQRPRGPRPSTHydrophilic
NLS Segment(s)
PositionSequence
142-157RGKRLKETAKQKLLRR
271-307RRDSRRQSRSRNSQRPRGPRPSTGAHSRHTSPRKRDR
Subcellular Location(s) extr 6, nucl 5, mito 4, cyto 4, golg 4, cyto_mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAHGLVAAAASSSPMEVSRVLTARAEDNTKFHPGEGAVDPGNINMQGLLALFAIIGAAFVLAAIWFFFWAKNGGFVWREGDWEEYKSTVLRRKDSNGRTLTNASKSTDLGGGSIVGRGYRDYDDHTTTVDTETVATGEKLSRGKRLKETAKQKLLRRHKDEQWEGSHDEDMRAYRHEKPARVGGMNREPEGTYHSSEYTGTLGQRSEWTQSEMGETHGETATRYDAETRYDIPDTDRAPNRNVSGFSFTAGEKDTISHITEEHQLRDSMHRRDSRRQSRSRNSQRPRGPRPSTGAHSRHTSPRKRDRSAIPGGYTTPLDMSSISASEYVYDQLEGCDAGVKTYHRPIPGLSKGYRRAGSGRGGRRDSLSDSEGDDYDSRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.08
4 0.11
5 0.16
6 0.17
7 0.19
8 0.2
9 0.21
10 0.23
11 0.26
12 0.28
13 0.24
14 0.27
15 0.29
16 0.34
17 0.32
18 0.29
19 0.28
20 0.24
21 0.27
22 0.26
23 0.26
24 0.2
25 0.21
26 0.21
27 0.18
28 0.19
29 0.14
30 0.12
31 0.07
32 0.07
33 0.06
34 0.06
35 0.07
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.03
50 0.03
51 0.03
52 0.04
53 0.05
54 0.05
55 0.06
56 0.09
57 0.1
58 0.13
59 0.13
60 0.17
61 0.18
62 0.18
63 0.2
64 0.18
65 0.19
66 0.17
67 0.21
68 0.18
69 0.19
70 0.2
71 0.17
72 0.17
73 0.18
74 0.22
75 0.25
76 0.29
77 0.32
78 0.35
79 0.42
80 0.51
81 0.54
82 0.58
83 0.57
84 0.54
85 0.53
86 0.53
87 0.51
88 0.46
89 0.43
90 0.36
91 0.31
92 0.29
93 0.27
94 0.24
95 0.19
96 0.14
97 0.11
98 0.1
99 0.09
100 0.1
101 0.08
102 0.06
103 0.07
104 0.07
105 0.09
106 0.09
107 0.1
108 0.13
109 0.17
110 0.2
111 0.2
112 0.21
113 0.19
114 0.19
115 0.19
116 0.14
117 0.1
118 0.08
119 0.08
120 0.07
121 0.07
122 0.06
123 0.06
124 0.06
125 0.09
126 0.13
127 0.14
128 0.22
129 0.27
130 0.32
131 0.38
132 0.46
133 0.51
134 0.56
135 0.65
136 0.67
137 0.72
138 0.74
139 0.73
140 0.75
141 0.77
142 0.78
143 0.76
144 0.73
145 0.7
146 0.73
147 0.72
148 0.67
149 0.61
150 0.55
151 0.48
152 0.42
153 0.37
154 0.28
155 0.23
156 0.18
157 0.15
158 0.12
159 0.13
160 0.14
161 0.16
162 0.25
163 0.29
164 0.29
165 0.31
166 0.35
167 0.36
168 0.35
169 0.33
170 0.3
171 0.33
172 0.33
173 0.31
174 0.26
175 0.23
176 0.22
177 0.25
178 0.21
179 0.14
180 0.14
181 0.14
182 0.13
183 0.13
184 0.14
185 0.1
186 0.09
187 0.08
188 0.08
189 0.08
190 0.08
191 0.1
192 0.1
193 0.12
194 0.11
195 0.14
196 0.13
197 0.13
198 0.15
199 0.13
200 0.14
201 0.12
202 0.11
203 0.1
204 0.1
205 0.1
206 0.08
207 0.08
208 0.08
209 0.08
210 0.08
211 0.09
212 0.09
213 0.12
214 0.13
215 0.14
216 0.16
217 0.16
218 0.16
219 0.16
220 0.2
221 0.2
222 0.25
223 0.28
224 0.28
225 0.3
226 0.32
227 0.32
228 0.3
229 0.29
230 0.24
231 0.25
232 0.23
233 0.21
234 0.19
235 0.18
236 0.16
237 0.16
238 0.14
239 0.09
240 0.1
241 0.11
242 0.11
243 0.12
244 0.11
245 0.1
246 0.12
247 0.19
248 0.2
249 0.2
250 0.2
251 0.2
252 0.21
253 0.29
254 0.34
255 0.32
256 0.38
257 0.43
258 0.47
259 0.57
260 0.67
261 0.69
262 0.72
263 0.76
264 0.79
265 0.83
266 0.89
267 0.9
268 0.9
269 0.87
270 0.87
271 0.87
272 0.87
273 0.86
274 0.85
275 0.8
276 0.74
277 0.72
278 0.69
279 0.66
280 0.65
281 0.6
282 0.53
283 0.53
284 0.51
285 0.54
286 0.57
287 0.6
288 0.61
289 0.67
290 0.74
291 0.74
292 0.78
293 0.76
294 0.75
295 0.75
296 0.71
297 0.62
298 0.54
299 0.5
300 0.44
301 0.37
302 0.28
303 0.2
304 0.14
305 0.12
306 0.1
307 0.1
308 0.09
309 0.09
310 0.09
311 0.09
312 0.09
313 0.09
314 0.1
315 0.1
316 0.09
317 0.09
318 0.09
319 0.09
320 0.09
321 0.09
322 0.08
323 0.11
324 0.11
325 0.11
326 0.14
327 0.16
328 0.2
329 0.27
330 0.31
331 0.28
332 0.29
333 0.32
334 0.39
335 0.45
336 0.47
337 0.44
338 0.49
339 0.55
340 0.61
341 0.59
342 0.53
343 0.49
344 0.47
345 0.51
346 0.52
347 0.54
348 0.56
349 0.58
350 0.57
351 0.56
352 0.55
353 0.5
354 0.46
355 0.39
356 0.31
357 0.3
358 0.31
359 0.28
360 0.27
361 0.23