Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AJ90

Protein Details
Accession A0A0D7AJ90   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-34LRNAVTRRSHRSSRHAPRRWNSSSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR006808  ATP_synth_F0_gsu_mt  
Gene Ontology GO:0000276  C:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015078  F:proton transmembrane transporter activity  
GO:0015986  P:proton motive force-driven ATP synthesis  
Pfam View protein in Pfam  
PF04718  ATP-synt_G  
Amino Acid Sequences MRPVPPLATLRNAVTRRSHRSSRHAPRRWNSSSPKDNAEKAKETLANSDTFVTVQKQVEQYWQVAKKALGPTGEKAVQLLGGYKEPVLYNLAVAREVAKLIYRKESMSPPRLADFMPTYRQLWSRASSRSYWTNALASGELMKVGIYGLEAYGIFKIGEIVGRRHLVGYGVPPTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.51
4 0.56
5 0.61
6 0.59
7 0.67
8 0.75
9 0.77
10 0.8
11 0.8
12 0.82
13 0.82
14 0.85
15 0.81
16 0.79
17 0.76
18 0.75
19 0.75
20 0.69
21 0.68
22 0.63
23 0.62
24 0.61
25 0.58
26 0.52
27 0.45
28 0.47
29 0.43
30 0.39
31 0.38
32 0.32
33 0.27
34 0.24
35 0.23
36 0.18
37 0.15
38 0.15
39 0.12
40 0.14
41 0.14
42 0.16
43 0.16
44 0.17
45 0.21
46 0.21
47 0.21
48 0.25
49 0.27
50 0.25
51 0.25
52 0.25
53 0.26
54 0.26
55 0.27
56 0.22
57 0.21
58 0.21
59 0.24
60 0.25
61 0.19
62 0.17
63 0.15
64 0.13
65 0.11
66 0.11
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.07
73 0.08
74 0.08
75 0.07
76 0.07
77 0.08
78 0.08
79 0.07
80 0.08
81 0.08
82 0.06
83 0.07
84 0.06
85 0.08
86 0.1
87 0.11
88 0.16
89 0.16
90 0.16
91 0.19
92 0.27
93 0.31
94 0.35
95 0.36
96 0.33
97 0.33
98 0.33
99 0.31
100 0.26
101 0.23
102 0.2
103 0.21
104 0.21
105 0.21
106 0.22
107 0.24
108 0.24
109 0.23
110 0.24
111 0.25
112 0.28
113 0.3
114 0.29
115 0.32
116 0.35
117 0.35
118 0.34
119 0.31
120 0.28
121 0.26
122 0.25
123 0.21
124 0.16
125 0.14
126 0.11
127 0.09
128 0.08
129 0.07
130 0.05
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.06
139 0.06
140 0.07
141 0.06
142 0.06
143 0.07
144 0.06
145 0.11
146 0.13
147 0.16
148 0.2
149 0.22
150 0.23
151 0.22
152 0.23
153 0.19
154 0.19
155 0.21