Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7ACK8

Protein Details
Accession A0A0D7ACK8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27SSSSSKAAKKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-21KAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences SSSSSKAAKKKKWSKGKVKDKAQHAVILDKPTYDRIFKEVPTFKFISQSILIERLKINGSLARVAISHLEKDGLIKRIVHHSAQRIYSESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.93
4 0.92
5 0.92
6 0.89
7 0.85
8 0.82
9 0.73
10 0.65
11 0.55
12 0.5
13 0.42
14 0.38
15 0.31
16 0.24
17 0.23
18 0.22
19 0.23
20 0.19
21 0.17
22 0.17
23 0.19
24 0.2
25 0.27
26 0.3
27 0.29
28 0.33
29 0.34
30 0.3
31 0.31
32 0.3
33 0.26
34 0.2
35 0.19
36 0.15
37 0.19
38 0.19
39 0.16
40 0.16
41 0.15
42 0.15
43 0.14
44 0.14
45 0.11
46 0.12
47 0.12
48 0.12
49 0.11
50 0.1
51 0.11
52 0.14
53 0.13
54 0.12
55 0.11
56 0.12
57 0.11
58 0.15
59 0.19
60 0.19
61 0.19
62 0.2
63 0.22
64 0.29
65 0.33
66 0.34
67 0.35
68 0.4
69 0.44
70 0.46
71 0.46