Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DFT1

Protein Details
Accession E9DFT1   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-81YLDSGEKRWKKPRERHAAASASHydrophilic
NLS Segment(s)
PositionSequence
67-73RWKKPRE
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MVPSHTQARAWASAGWDAFRSMELSWAEGQRRHKKASPLRHRPQPCLASRLAELKLRFVYLDSGEKRWKKPRERHAAASASLSDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.17
4 0.16
5 0.14
6 0.13
7 0.13
8 0.09
9 0.13
10 0.12
11 0.14
12 0.15
13 0.18
14 0.2
15 0.22
16 0.31
17 0.36
18 0.4
19 0.43
20 0.45
21 0.52
22 0.58
23 0.66
24 0.68
25 0.69
26 0.72
27 0.77
28 0.76
29 0.7
30 0.69
31 0.65
32 0.56
33 0.49
34 0.42
35 0.35
36 0.33
37 0.32
38 0.27
39 0.24
40 0.22
41 0.21
42 0.21
43 0.19
44 0.18
45 0.15
46 0.16
47 0.14
48 0.22
49 0.21
50 0.25
51 0.33
52 0.37
53 0.43
54 0.51
55 0.58
56 0.6
57 0.68
58 0.75
59 0.78
60 0.81
61 0.83
62 0.82
63 0.77
64 0.68
65 0.61