Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AFQ1

Protein Details
Accession A0A0D7AFQ1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
335-369EAATSHSGKKRKRTSKGASKSKRTRKGAKGASGVDHydrophilic
NLS Segment(s)
PositionSequence
342-364GKKRKRTSKGASKSKRTRKGAKG
Subcellular Location(s) cyto 18.5, cyto_mito 10.833, nucl 6.5, mito_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MSALVHGSAGCPSSGNAYNAFYHNKAKELRELGVELPPGGVVALHNEYDEEYEALSKEERAELVESLKEDKANQACSRKQTTPAKTQDFVASCKVLADVFRGMKRRIGVDGFMVAISNDVGFEPKPFIYFSEEEIEKYMTMAVKKWDSPRVAALVQAFASAGCDVANLTKTSQEKARYLKAEIVQRMNSALVETTGKPDARMEYVHYHSRIVQGLSVVLEGWPLDKLEQPSWLGNSLVLLRKVRDALKDGTCHFRKIDKVERDHLYCEWKLKVANGELVEPTRKERVDKGISRGSRTLNAHDHDNPSDDEGDNGENIDNGPPTHPEDANVADASEAATSHSGKKRKRTSKGASKSKRTRKGAKGASGVDNQGGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.22
5 0.25
6 0.28
7 0.32
8 0.29
9 0.33
10 0.33
11 0.37
12 0.39
13 0.4
14 0.44
15 0.44
16 0.44
17 0.39
18 0.4
19 0.35
20 0.34
21 0.32
22 0.24
23 0.19
24 0.17
25 0.13
26 0.11
27 0.09
28 0.05
29 0.09
30 0.11
31 0.11
32 0.11
33 0.11
34 0.12
35 0.13
36 0.15
37 0.1
38 0.09
39 0.1
40 0.1
41 0.11
42 0.12
43 0.11
44 0.11
45 0.12
46 0.12
47 0.13
48 0.14
49 0.14
50 0.16
51 0.17
52 0.16
53 0.18
54 0.19
55 0.18
56 0.17
57 0.23
58 0.25
59 0.29
60 0.34
61 0.39
62 0.42
63 0.48
64 0.54
65 0.5
66 0.55
67 0.58
68 0.6
69 0.62
70 0.67
71 0.66
72 0.6
73 0.59
74 0.57
75 0.49
76 0.45
77 0.38
78 0.3
79 0.23
80 0.23
81 0.21
82 0.15
83 0.13
84 0.13
85 0.14
86 0.17
87 0.21
88 0.25
89 0.26
90 0.29
91 0.3
92 0.29
93 0.27
94 0.25
95 0.22
96 0.19
97 0.19
98 0.17
99 0.15
100 0.13
101 0.09
102 0.07
103 0.06
104 0.05
105 0.04
106 0.04
107 0.05
108 0.05
109 0.06
110 0.08
111 0.08
112 0.09
113 0.09
114 0.11
115 0.15
116 0.16
117 0.18
118 0.21
119 0.22
120 0.21
121 0.22
122 0.22
123 0.16
124 0.15
125 0.14
126 0.1
127 0.1
128 0.12
129 0.13
130 0.15
131 0.18
132 0.22
133 0.26
134 0.26
135 0.27
136 0.27
137 0.27
138 0.25
139 0.24
140 0.2
141 0.15
142 0.14
143 0.13
144 0.1
145 0.07
146 0.07
147 0.05
148 0.05
149 0.04
150 0.04
151 0.04
152 0.05
153 0.06
154 0.06
155 0.06
156 0.1
157 0.11
158 0.13
159 0.17
160 0.19
161 0.22
162 0.26
163 0.31
164 0.3
165 0.3
166 0.33
167 0.33
168 0.36
169 0.35
170 0.34
171 0.29
172 0.27
173 0.26
174 0.21
175 0.17
176 0.11
177 0.08
178 0.06
179 0.07
180 0.07
181 0.08
182 0.11
183 0.11
184 0.11
185 0.12
186 0.12
187 0.12
188 0.12
189 0.14
190 0.16
191 0.2
192 0.24
193 0.23
194 0.23
195 0.23
196 0.24
197 0.23
198 0.18
199 0.15
200 0.11
201 0.11
202 0.1
203 0.09
204 0.07
205 0.05
206 0.05
207 0.04
208 0.04
209 0.04
210 0.04
211 0.05
212 0.08
213 0.1
214 0.11
215 0.14
216 0.15
217 0.16
218 0.16
219 0.17
220 0.14
221 0.11
222 0.12
223 0.13
224 0.14
225 0.15
226 0.15
227 0.15
228 0.16
229 0.19
230 0.21
231 0.2
232 0.21
233 0.24
234 0.28
235 0.3
236 0.31
237 0.38
238 0.37
239 0.36
240 0.34
241 0.33
242 0.33
243 0.37
244 0.45
245 0.43
246 0.47
247 0.53
248 0.57
249 0.55
250 0.53
251 0.47
252 0.44
253 0.37
254 0.35
255 0.29
256 0.26
257 0.25
258 0.25
259 0.27
260 0.23
261 0.26
262 0.23
263 0.23
264 0.22
265 0.24
266 0.24
267 0.2
268 0.21
269 0.21
270 0.22
271 0.23
272 0.26
273 0.33
274 0.4
275 0.44
276 0.48
277 0.52
278 0.54
279 0.56
280 0.55
281 0.48
282 0.46
283 0.43
284 0.43
285 0.41
286 0.4
287 0.41
288 0.41
289 0.43
290 0.37
291 0.38
292 0.32
293 0.28
294 0.27
295 0.22
296 0.19
297 0.16
298 0.16
299 0.13
300 0.13
301 0.1
302 0.09
303 0.09
304 0.1
305 0.1
306 0.09
307 0.11
308 0.12
309 0.17
310 0.2
311 0.2
312 0.19
313 0.22
314 0.24
315 0.25
316 0.23
317 0.19
318 0.15
319 0.14
320 0.13
321 0.1
322 0.08
323 0.06
324 0.08
325 0.1
326 0.18
327 0.25
328 0.33
329 0.39
330 0.5
331 0.59
332 0.68
333 0.76
334 0.79
335 0.83
336 0.86
337 0.91
338 0.92
339 0.92
340 0.92
341 0.93
342 0.93
343 0.93
344 0.91
345 0.9
346 0.89
347 0.89
348 0.88
349 0.85
350 0.82
351 0.77
352 0.75
353 0.68
354 0.6
355 0.51