Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AF56

Protein Details
Accession A0A0D7AF56   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-35PKEATKTKRKSAKSDAPRKGTRAKKDPNAPKRPLBasic
NLS Segment(s)
PositionSequence
7-33KTKRKSAKSDAPRKGTRAKKDPNAPKR
99-103EKKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEATKTKRKSAKSDAPRKGTRAKKDPNAPKRPLSAYMFFSQDWRDRVRAENPDATFGEVGKLLGAKWKEMNDDDKKPYTQQAKADKVRAEKEKEAYEKKKKSGGSDDAEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.82
4 0.82
5 0.81
6 0.77
7 0.76
8 0.74
9 0.72
10 0.71
11 0.71
12 0.71
13 0.77
14 0.83
15 0.84
16 0.85
17 0.8
18 0.74
19 0.7
20 0.64
21 0.59
22 0.54
23 0.47
24 0.41
25 0.38
26 0.35
27 0.3
28 0.28
29 0.25
30 0.24
31 0.23
32 0.22
33 0.21
34 0.2
35 0.24
36 0.28
37 0.31
38 0.3
39 0.33
40 0.31
41 0.33
42 0.32
43 0.29
44 0.23
45 0.17
46 0.14
47 0.09
48 0.08
49 0.05
50 0.05
51 0.04
52 0.08
53 0.09
54 0.09
55 0.11
56 0.13
57 0.15
58 0.17
59 0.25
60 0.27
61 0.33
62 0.36
63 0.37
64 0.38
65 0.37
66 0.42
67 0.4
68 0.38
69 0.4
70 0.46
71 0.52
72 0.56
73 0.6
74 0.57
75 0.57
76 0.6
77 0.59
78 0.56
79 0.52
80 0.53
81 0.55
82 0.58
83 0.62
84 0.65
85 0.68
86 0.69
87 0.69
88 0.7
89 0.65
90 0.65
91 0.64
92 0.63
93 0.59
94 0.56