Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7AKN8

Protein Details
Accession A0A0D7AKN8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
128-152KGASSSKPKADKKKRMSQGSKINKSHydrophilic
209-247IKHYVRSHPQQQKPKNEPKKTKPPPPPSRKAPPPPPPPPBasic
NLS Segment(s)
PositionSequence
120-144KKKVEKELKGASSSKPKADKKKRMS
221-267KPKNEPKKTKPPPPPSRKAPPPPPPPPPPPTNSAPPPPPPPPPPPPA
Subcellular Location(s) cyto 11.5, cyto_nucl 10.333, cyto_mito 10.166, mito 7.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
IPR011993  PH-like_dom_sf  
IPR011026  WAS_C  
IPR028290  WASH1  
IPR033927  WASPfam_EVH1  
IPR000697  WH1/EVH1_dom  
Gene Ontology GO:0005769  C:early endosome  
GO:0071203  C:WASH complex  
GO:0043014  F:alpha-tubulin binding  
GO:0034314  P:Arp2/3 complex-mediated actin nucleation  
Pfam View protein in Pfam  
PF00786  PBD  
PF00568  WH1  
PROSITE View protein in PROSITE  
PS50108  CRIB  
PS50229  WH1  
CDD cd00132  CRIB  
cd01205  EVH1_WASP-like  
Amino Acid Sequences MPSQSTLNADEKAKVKSAIPTPSNRIFFAALSRIYYAYPEPDRWAYAGLQGALAISKDTTKNILSFNLVDLNGTRGVIWQHEFYDGLEYFSDRTFFHSFAGDKCMIGFVFADESEAKTFKKKVEKELKGASSSKPKADKKKRMSQGSKINKSMISGPMSGSFVHVAHMGYDAESGFVSKNVDPSWTAFLEGLEGAGIDREVIEKEIDFIKHYVRSHPQQQKPKNEPKKTKPPPPPSRKAPPPPPPPPPPPTNSAPPPPPPPPPPPPAGRAFGPAASMPMAQPERSGLLASITSGPGIGGLRKTDGPNTHRPASSSTPVPATTSSTGTTESSVTNGGGGGGGGGGDLTQALAAALMQRNKKLGDSDSEDDVDDDWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.34
4 0.39
5 0.43
6 0.45
7 0.48
8 0.53
9 0.6
10 0.6
11 0.53
12 0.49
13 0.41
14 0.36
15 0.34
16 0.32
17 0.25
18 0.24
19 0.24
20 0.22
21 0.21
22 0.22
23 0.19
24 0.2
25 0.23
26 0.23
27 0.27
28 0.28
29 0.29
30 0.28
31 0.29
32 0.23
33 0.22
34 0.23
35 0.19
36 0.16
37 0.15
38 0.14
39 0.12
40 0.12
41 0.08
42 0.06
43 0.09
44 0.1
45 0.11
46 0.14
47 0.15
48 0.17
49 0.19
50 0.2
51 0.2
52 0.2
53 0.2
54 0.22
55 0.2
56 0.18
57 0.17
58 0.18
59 0.15
60 0.15
61 0.13
62 0.1
63 0.11
64 0.13
65 0.15
66 0.14
67 0.14
68 0.15
69 0.16
70 0.14
71 0.19
72 0.17
73 0.16
74 0.14
75 0.14
76 0.14
77 0.14
78 0.15
79 0.09
80 0.15
81 0.16
82 0.16
83 0.16
84 0.19
85 0.2
86 0.2
87 0.26
88 0.21
89 0.18
90 0.18
91 0.18
92 0.14
93 0.14
94 0.12
95 0.07
96 0.08
97 0.08
98 0.09
99 0.08
100 0.1
101 0.11
102 0.12
103 0.12
104 0.14
105 0.17
106 0.21
107 0.3
108 0.33
109 0.42
110 0.52
111 0.57
112 0.59
113 0.65
114 0.63
115 0.57
116 0.56
117 0.49
118 0.48
119 0.44
120 0.43
121 0.44
122 0.48
123 0.55
124 0.64
125 0.71
126 0.7
127 0.78
128 0.82
129 0.83
130 0.83
131 0.8
132 0.8
133 0.8
134 0.78
135 0.7
136 0.63
137 0.52
138 0.47
139 0.42
140 0.34
141 0.26
142 0.2
143 0.18
144 0.18
145 0.18
146 0.17
147 0.14
148 0.12
149 0.09
150 0.09
151 0.09
152 0.07
153 0.07
154 0.08
155 0.07
156 0.06
157 0.07
158 0.06
159 0.05
160 0.05
161 0.05
162 0.04
163 0.05
164 0.07
165 0.07
166 0.08
167 0.08
168 0.09
169 0.09
170 0.11
171 0.13
172 0.12
173 0.12
174 0.1
175 0.1
176 0.1
177 0.09
178 0.07
179 0.04
180 0.04
181 0.03
182 0.03
183 0.03
184 0.02
185 0.02
186 0.03
187 0.03
188 0.04
189 0.04
190 0.04
191 0.06
192 0.08
193 0.08
194 0.09
195 0.1
196 0.11
197 0.16
198 0.16
199 0.2
200 0.24
201 0.28
202 0.37
203 0.46
204 0.52
205 0.58
206 0.65
207 0.71
208 0.75
209 0.82
210 0.82
211 0.82
212 0.84
213 0.83
214 0.86
215 0.85
216 0.85
217 0.85
218 0.85
219 0.87
220 0.87
221 0.86
222 0.83
223 0.84
224 0.84
225 0.83
226 0.81
227 0.81
228 0.8
229 0.79
230 0.79
231 0.76
232 0.74
233 0.7
234 0.65
235 0.58
236 0.53
237 0.51
238 0.5
239 0.47
240 0.46
241 0.45
242 0.44
243 0.47
244 0.45
245 0.47
246 0.45
247 0.48
248 0.49
249 0.49
250 0.49
251 0.47
252 0.48
253 0.46
254 0.44
255 0.38
256 0.35
257 0.32
258 0.28
259 0.25
260 0.2
261 0.17
262 0.15
263 0.14
264 0.1
265 0.14
266 0.15
267 0.14
268 0.14
269 0.14
270 0.15
271 0.15
272 0.15
273 0.09
274 0.09
275 0.1
276 0.1
277 0.11
278 0.09
279 0.09
280 0.08
281 0.08
282 0.07
283 0.08
284 0.09
285 0.09
286 0.1
287 0.12
288 0.15
289 0.17
290 0.21
291 0.28
292 0.33
293 0.41
294 0.47
295 0.5
296 0.48
297 0.49
298 0.49
299 0.48
300 0.47
301 0.4
302 0.36
303 0.33
304 0.33
305 0.33
306 0.28
307 0.26
308 0.24
309 0.22
310 0.21
311 0.19
312 0.21
313 0.2
314 0.2
315 0.16
316 0.14
317 0.13
318 0.13
319 0.12
320 0.1
321 0.1
322 0.09
323 0.07
324 0.07
325 0.05
326 0.04
327 0.04
328 0.03
329 0.03
330 0.03
331 0.03
332 0.03
333 0.03
334 0.03
335 0.03
336 0.03
337 0.03
338 0.03
339 0.08
340 0.13
341 0.18
342 0.22
343 0.24
344 0.27
345 0.28
346 0.31
347 0.31
348 0.3
349 0.33
350 0.38
351 0.39
352 0.4
353 0.4
354 0.38
355 0.34