Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7ADP5

Protein Details
Accession A0A0D7ADP5    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-72VAPRRSSRIKEQPSKPEPVKKATKPRAKKVDKDAEAKDSEKPKSARGRKRKAPEPTDEBasic
NLS Segment(s)
PositionSequence
18-68RRSSRIKEQPSKPEPVKKATKPRAKKVDKDAEAKDSEKPKSARGRKRKAPE
82-177GGEPPAKKAKPASKATEKPASKVAQKPASKPASKATEKPASKPASRASKPASRAGSKAPSRAASAKPPSRAASAKPPSRAGSRKPASRAGSKKPSS
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPRKAVVTAEDGEHVAPRRSSRIKEQPSKPEPVKKATKPRAKKVDKDAEAKDSEKPKSARGRKRKAPEPTDEAQPEAAAANGGEPPAKKAKPASKATEKPASKVAQKPASKPASKATEKPASKPASRASKPASRAGSKAPSRAASAKPPSRAASAKPPSRAGSRKPASRAGSKKPSSKIEGQEPAATAAPIQEAIAEEPEAEEAAAAADAPAADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.2
4 0.21
5 0.28
6 0.34
7 0.38
8 0.45
9 0.53
10 0.61
11 0.68
12 0.75
13 0.77
14 0.77
15 0.81
16 0.78
17 0.76
18 0.71
19 0.7
20 0.71
21 0.69
22 0.75
23 0.76
24 0.8
25 0.79
26 0.85
27 0.87
28 0.85
29 0.84
30 0.83
31 0.84
32 0.79
33 0.77
34 0.7
35 0.65
36 0.6
37 0.53
38 0.49
39 0.44
40 0.4
41 0.4
42 0.38
43 0.39
44 0.47
45 0.56
46 0.6
47 0.65
48 0.73
49 0.75
50 0.84
51 0.85
52 0.85
53 0.81
54 0.78
55 0.74
56 0.66
57 0.64
58 0.56
59 0.47
60 0.37
61 0.31
62 0.23
63 0.16
64 0.13
65 0.06
66 0.05
67 0.04
68 0.04
69 0.05
70 0.05
71 0.05
72 0.08
73 0.14
74 0.15
75 0.15
76 0.21
77 0.28
78 0.35
79 0.41
80 0.46
81 0.5
82 0.54
83 0.58
84 0.61
85 0.55
86 0.48
87 0.48
88 0.43
89 0.37
90 0.38
91 0.39
92 0.38
93 0.4
94 0.41
95 0.43
96 0.47
97 0.44
98 0.4
99 0.4
100 0.4
101 0.4
102 0.4
103 0.39
104 0.41
105 0.41
106 0.43
107 0.44
108 0.41
109 0.39
110 0.4
111 0.4
112 0.41
113 0.41
114 0.43
115 0.41
116 0.42
117 0.44
118 0.47
119 0.45
120 0.37
121 0.38
122 0.38
123 0.42
124 0.38
125 0.38
126 0.34
127 0.31
128 0.32
129 0.34
130 0.32
131 0.31
132 0.38
133 0.4
134 0.41
135 0.42
136 0.41
137 0.41
138 0.41
139 0.36
140 0.38
141 0.42
142 0.44
143 0.44
144 0.46
145 0.45
146 0.5
147 0.52
148 0.47
149 0.49
150 0.51
151 0.54
152 0.55
153 0.6
154 0.57
155 0.61
156 0.63
157 0.61
158 0.65
159 0.64
160 0.67
161 0.66
162 0.67
163 0.64
164 0.64
165 0.61
166 0.6
167 0.61
168 0.56
169 0.53
170 0.47
171 0.43
172 0.36
173 0.3
174 0.2
175 0.14
176 0.12
177 0.09
178 0.08
179 0.07
180 0.07
181 0.09
182 0.1
183 0.1
184 0.09
185 0.09
186 0.1
187 0.09
188 0.08
189 0.06
190 0.04
191 0.05
192 0.05
193 0.04
194 0.04
195 0.04