Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AMN1

Protein Details
Accession A0A0D7AMN1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-26RLYCKGRVLGHKRAKRNTRPNTSLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences DRLYCKGRVLGHKRAKRNTRPNTSLLQIEGVADKTAAQFYLGKRVAYVYKAKRAIAGSNIRVIWGRVTRPHGNSGVVKSKFRSNLPPKAFGASVRIMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.86
5 0.86
6 0.86
7 0.82
8 0.77
9 0.71
10 0.64
11 0.55
12 0.44
13 0.35
14 0.25
15 0.2
16 0.18
17 0.13
18 0.11
19 0.09
20 0.08
21 0.07
22 0.07
23 0.06
24 0.06
25 0.09
26 0.09
27 0.19
28 0.2
29 0.19
30 0.19
31 0.21
32 0.21
33 0.21
34 0.28
35 0.22
36 0.28
37 0.3
38 0.3
39 0.31
40 0.31
41 0.3
42 0.29
43 0.31
44 0.24
45 0.26
46 0.26
47 0.23
48 0.23
49 0.21
50 0.18
51 0.15
52 0.16
53 0.17
54 0.24
55 0.29
56 0.31
57 0.34
58 0.32
59 0.33
60 0.34
61 0.35
62 0.38
63 0.35
64 0.35
65 0.33
66 0.38
67 0.39
68 0.39
69 0.45
70 0.44
71 0.52
72 0.55
73 0.59
74 0.54
75 0.54
76 0.51
77 0.42
78 0.39
79 0.31
80 0.28
81 0.24
82 0.23
83 0.19