Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DGP9

Protein Details
Accession E9DGP9    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
9-29MSQPPSTFRTKQKPERLPITVHydrophilic
196-227SIRNEGRKERMERIRRNERKMRANMRRTGNAKBasic
NLS Segment(s)
PositionSequence
198-230RNEGRKERMERIRRNERKMRANMRRTGNAKSKA
Subcellular Location(s) nucl 19, cyto_nucl 12.333, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0016740  F:transferase activity  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSSGQTDAMSQPPSTFRTKQKPERLPITVEKPTPYTFDLGRLMALDPNPLNLPSNSLSNPPVLNSTLKSTARDGAQCLLNQLLTACPITSSATDGVLLTLPTPVTPLPRFKPLPTPKPPTKWELFARKKGIGKYNNKLGANEAERQKKLVYDEEKGEWVPRWGYKGKNKAEDDQWLVEVDDKKWKKEEDMNIRGESIRNEGRKERMERIRRNERKMRANMRRTGNAKSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.39
4 0.48
5 0.58
6 0.66
7 0.74
8 0.79
9 0.81
10 0.83
11 0.78
12 0.74
13 0.71
14 0.68
15 0.64
16 0.57
17 0.51
18 0.46
19 0.43
20 0.4
21 0.34
22 0.29
23 0.23
24 0.25
25 0.25
26 0.22
27 0.21
28 0.19
29 0.18
30 0.17
31 0.17
32 0.16
33 0.13
34 0.15
35 0.15
36 0.15
37 0.16
38 0.14
39 0.17
40 0.15
41 0.18
42 0.18
43 0.19
44 0.19
45 0.19
46 0.2
47 0.16
48 0.17
49 0.16
50 0.16
51 0.15
52 0.18
53 0.23
54 0.24
55 0.25
56 0.24
57 0.26
58 0.26
59 0.26
60 0.24
61 0.2
62 0.22
63 0.2
64 0.2
65 0.17
66 0.14
67 0.13
68 0.12
69 0.08
70 0.07
71 0.07
72 0.06
73 0.05
74 0.06
75 0.07
76 0.07
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.07
84 0.07
85 0.05
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.09
92 0.11
93 0.15
94 0.17
95 0.24
96 0.25
97 0.26
98 0.36
99 0.4
100 0.47
101 0.5
102 0.56
103 0.55
104 0.6
105 0.61
106 0.56
107 0.51
108 0.47
109 0.47
110 0.5
111 0.51
112 0.52
113 0.53
114 0.52
115 0.54
116 0.52
117 0.53
118 0.51
119 0.52
120 0.51
121 0.55
122 0.57
123 0.54
124 0.5
125 0.44
126 0.41
127 0.36
128 0.36
129 0.34
130 0.34
131 0.33
132 0.35
133 0.33
134 0.29
135 0.28
136 0.31
137 0.28
138 0.26
139 0.29
140 0.29
141 0.3
142 0.28
143 0.27
144 0.2
145 0.18
146 0.17
147 0.15
148 0.19
149 0.21
150 0.28
151 0.36
152 0.44
153 0.49
154 0.56
155 0.58
156 0.58
157 0.58
158 0.57
159 0.53
160 0.45
161 0.39
162 0.3
163 0.27
164 0.27
165 0.25
166 0.2
167 0.26
168 0.26
169 0.28
170 0.32
171 0.33
172 0.34
173 0.4
174 0.49
175 0.5
176 0.57
177 0.59
178 0.55
179 0.55
180 0.5
181 0.43
182 0.34
183 0.3
184 0.29
185 0.28
186 0.31
187 0.35
188 0.41
189 0.48
190 0.52
191 0.55
192 0.58
193 0.65
194 0.71
195 0.76
196 0.81
197 0.82
198 0.86
199 0.86
200 0.84
201 0.84
202 0.85
203 0.86
204 0.85
205 0.86
206 0.84
207 0.83
208 0.83
209 0.76
210 0.75