Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AGZ9

Protein Details
Accession A0A0D7AGZ9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-23TLEQLKKPKLKSKPMTSLLKLHydrophilic
NLS Segment(s)
PositionSequence
62-73KSKAKKKKTAAS
Subcellular Location(s) nucl 21, mito_nucl 12.833, cyto_nucl 12.333, mito 3.5
Family & Domain DBs
Amino Acid Sequences MYTLEQLKKPKLKSKPMTSLLKLKYDEPFNMFEAQILVKIDKCVTIDSDANDSDSDLDVVHKSKAKKKKTAASKESKILPSNVKLFADLYAKKVVTSSLVQQYHIARGLVQPRSSSLYLRSHCAAIHGAYGLSNDIAITLKKKKYTSTKALQQMEVGHLEENVLQTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.81
4 0.83
5 0.79
6 0.79
7 0.72
8 0.68
9 0.6
10 0.52
11 0.49
12 0.44
13 0.42
14 0.36
15 0.35
16 0.3
17 0.31
18 0.28
19 0.22
20 0.19
21 0.17
22 0.15
23 0.13
24 0.12
25 0.11
26 0.12
27 0.12
28 0.12
29 0.13
30 0.12
31 0.12
32 0.15
33 0.16
34 0.16
35 0.19
36 0.17
37 0.17
38 0.16
39 0.15
40 0.12
41 0.11
42 0.09
43 0.06
44 0.07
45 0.07
46 0.08
47 0.1
48 0.13
49 0.16
50 0.25
51 0.34
52 0.4
53 0.48
54 0.54
55 0.61
56 0.67
57 0.75
58 0.76
59 0.76
60 0.73
61 0.69
62 0.66
63 0.61
64 0.51
65 0.43
66 0.37
67 0.3
68 0.29
69 0.26
70 0.21
71 0.19
72 0.18
73 0.17
74 0.18
75 0.15
76 0.15
77 0.16
78 0.16
79 0.16
80 0.15
81 0.14
82 0.12
83 0.13
84 0.14
85 0.2
86 0.2
87 0.21
88 0.23
89 0.24
90 0.23
91 0.23
92 0.19
93 0.12
94 0.15
95 0.21
96 0.21
97 0.21
98 0.2
99 0.2
100 0.25
101 0.25
102 0.23
103 0.22
104 0.27
105 0.27
106 0.3
107 0.3
108 0.26
109 0.25
110 0.26
111 0.23
112 0.15
113 0.15
114 0.12
115 0.1
116 0.1
117 0.1
118 0.09
119 0.07
120 0.06
121 0.05
122 0.05
123 0.06
124 0.07
125 0.11
126 0.18
127 0.23
128 0.28
129 0.3
130 0.37
131 0.47
132 0.56
133 0.61
134 0.63
135 0.69
136 0.73
137 0.76
138 0.69
139 0.61
140 0.54
141 0.48
142 0.4
143 0.31
144 0.22
145 0.17
146 0.17
147 0.16