Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AKL4

Protein Details
Accession A0A0D7AKL4   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-112SNLDKARKYRRTKSDLQRDMRKWHydrophilic
NLS Segment(s)
PositionSequence
96-103RKYRRTKS
107-122RDMRKWEEERKRGLKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039577  Rad18  
Gene Ontology GO:0003697  F:single-stranded DNA binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0006301  P:postreplication repair  
GO:0006513  P:protein monoubiquitination  
Amino Acid Sequences MERINAHLDRKCESDVSETQKSQWNKLLNGKGKEKADNDELDEDPIPKASYDTLKDKQLKRLLEECDLPTTGDRVAWLARHQKWRNIFNSNLDKARKYRRTKSDLQRDMRKWEEERKRGLKKPVSVDDTLAYEVTTVSILQRVFGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.37
4 0.41
5 0.38
6 0.39
7 0.45
8 0.45
9 0.43
10 0.44
11 0.41
12 0.39
13 0.47
14 0.54
15 0.55
16 0.59
17 0.6
18 0.6
19 0.58
20 0.58
21 0.52
22 0.47
23 0.43
24 0.38
25 0.36
26 0.33
27 0.3
28 0.27
29 0.25
30 0.21
31 0.16
32 0.16
33 0.13
34 0.09
35 0.1
36 0.09
37 0.12
38 0.15
39 0.22
40 0.24
41 0.31
42 0.38
43 0.4
44 0.47
45 0.49
46 0.46
47 0.44
48 0.47
49 0.42
50 0.38
51 0.38
52 0.31
53 0.27
54 0.26
55 0.21
56 0.16
57 0.14
58 0.11
59 0.08
60 0.07
61 0.06
62 0.06
63 0.07
64 0.1
65 0.17
66 0.21
67 0.32
68 0.34
69 0.38
70 0.44
71 0.5
72 0.51
73 0.48
74 0.46
75 0.44
76 0.5
77 0.48
78 0.47
79 0.42
80 0.4
81 0.4
82 0.49
83 0.5
84 0.5
85 0.57
86 0.61
87 0.66
88 0.74
89 0.8
90 0.81
91 0.81
92 0.81
93 0.81
94 0.75
95 0.75
96 0.69
97 0.64
98 0.57
99 0.58
100 0.6
101 0.57
102 0.63
103 0.66
104 0.7
105 0.72
106 0.78
107 0.75
108 0.72
109 0.75
110 0.74
111 0.7
112 0.62
113 0.57
114 0.49
115 0.43
116 0.37
117 0.28
118 0.19
119 0.13
120 0.12
121 0.1
122 0.09
123 0.06
124 0.06
125 0.1
126 0.1