Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7A2L2

Protein Details
Accession A0A0D7A2L2   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VNIPKCVFRNCKGKNCQKHTPHKVTQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKCVFRNCKGKNCQKHTPHKVTQYKKGKDSVYAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKYKMQMSLKRCKHFELGGEKKTKGAALTFLCKIPVDSAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.82
4 0.85
5 0.84
6 0.87
7 0.87
8 0.87
9 0.84
10 0.83
11 0.85
12 0.82
13 0.82
14 0.82
15 0.77
16 0.72
17 0.71
18 0.61
19 0.57
20 0.55
21 0.54
22 0.54
23 0.54
24 0.55
25 0.56
26 0.59
27 0.59
28 0.62
29 0.59
30 0.59
31 0.61
32 0.62
33 0.63
34 0.62
35 0.63
36 0.61
37 0.61
38 0.52
39 0.46
40 0.42
41 0.35
42 0.37
43 0.38
44 0.36
45 0.3
46 0.36
47 0.4
48 0.48
49 0.57
50 0.59
51 0.59
52 0.62
53 0.69
54 0.7
55 0.68
56 0.64
57 0.59
58 0.56
59 0.54
60 0.49
61 0.44
62 0.41
63 0.35
64 0.3
65 0.28
66 0.27
67 0.32
68 0.38
69 0.42
70 0.45
71 0.55
72 0.62
73 0.67
74 0.64
75 0.59
76 0.55
77 0.5
78 0.49
79 0.5
80 0.5
81 0.51
82 0.54
83 0.51
84 0.47
85 0.46
86 0.4
87 0.3
88 0.23
89 0.22
90 0.22
91 0.28
92 0.29
93 0.29
94 0.29
95 0.27
96 0.27