Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7A557

Protein Details
Accession A0A0D7A557   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
330-356LAEKTVVRREKKAKKAEQLRKRLTNLTHydrophilic
NLS Segment(s)
PositionSequence
312-351QRAMRERRLAARKARLVPLAEKTVVRREKKAKKAEQLRKR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MSPRLLSPLKGFYRQQLSVGVTTTSPWTTDFRHLARIPRKHLQRLQDGSISFRAADTRDRIKYWNVVPGDQIRIKGLDNRIRDVALINRVTNRVYVRGPSDAFDSKTQGVRHKNYHYSRCQLYLGEFEYPSVGPSEPPKTVRVFAKRVGTTKPKWNAHLRRYEWERFASATEPRLPPGQESKPVIPWPRPPKRELHEPGVLDTPQHIVAEVTYKPPAFSPVAKHEVPKPPSEASFLRALYNPRYFLSPNAPVEIYLYRELSNPHSRANKLERRKTFMRQKSALLKDFLAQELGDLRGRSAREAKVDAFWKWQRAMRERRLAARKARLVPLAEKTVVRREKKAKKAEQLRKRLTNLTLKEEENQLLPESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.43
4 0.41
5 0.37
6 0.36
7 0.3
8 0.21
9 0.21
10 0.22
11 0.17
12 0.14
13 0.14
14 0.16
15 0.19
16 0.27
17 0.32
18 0.32
19 0.4
20 0.43
21 0.51
22 0.58
23 0.62
24 0.62
25 0.65
26 0.71
27 0.72
28 0.75
29 0.74
30 0.74
31 0.72
32 0.69
33 0.65
34 0.57
35 0.51
36 0.47
37 0.39
38 0.29
39 0.23
40 0.2
41 0.17
42 0.22
43 0.23
44 0.29
45 0.31
46 0.33
47 0.36
48 0.38
49 0.43
50 0.4
51 0.42
52 0.36
53 0.33
54 0.35
55 0.36
56 0.4
57 0.35
58 0.33
59 0.26
60 0.26
61 0.26
62 0.29
63 0.33
64 0.33
65 0.34
66 0.37
67 0.36
68 0.35
69 0.34
70 0.3
71 0.27
72 0.27
73 0.26
74 0.24
75 0.25
76 0.26
77 0.27
78 0.27
79 0.24
80 0.2
81 0.2
82 0.21
83 0.22
84 0.25
85 0.25
86 0.23
87 0.26
88 0.25
89 0.26
90 0.25
91 0.26
92 0.24
93 0.28
94 0.29
95 0.31
96 0.37
97 0.4
98 0.45
99 0.49
100 0.56
101 0.59
102 0.65
103 0.64
104 0.62
105 0.59
106 0.55
107 0.49
108 0.4
109 0.34
110 0.29
111 0.25
112 0.21
113 0.18
114 0.16
115 0.15
116 0.15
117 0.13
118 0.11
119 0.09
120 0.08
121 0.12
122 0.15
123 0.16
124 0.18
125 0.2
126 0.21
127 0.25
128 0.3
129 0.34
130 0.34
131 0.36
132 0.42
133 0.42
134 0.42
135 0.45
136 0.45
137 0.43
138 0.48
139 0.52
140 0.48
141 0.5
142 0.58
143 0.61
144 0.61
145 0.67
146 0.61
147 0.6
148 0.63
149 0.63
150 0.55
151 0.47
152 0.41
153 0.32
154 0.3
155 0.24
156 0.19
157 0.18
158 0.2
159 0.19
160 0.19
161 0.2
162 0.19
163 0.19
164 0.23
165 0.23
166 0.23
167 0.26
168 0.26
169 0.27
170 0.31
171 0.31
172 0.28
173 0.33
174 0.39
175 0.45
176 0.47
177 0.46
178 0.5
179 0.52
180 0.6
181 0.57
182 0.52
183 0.48
184 0.46
185 0.45
186 0.4
187 0.35
188 0.24
189 0.2
190 0.15
191 0.11
192 0.1
193 0.08
194 0.06
195 0.06
196 0.09
197 0.09
198 0.09
199 0.1
200 0.11
201 0.11
202 0.11
203 0.14
204 0.13
205 0.15
206 0.18
207 0.23
208 0.28
209 0.29
210 0.3
211 0.33
212 0.4
213 0.41
214 0.38
215 0.35
216 0.31
217 0.32
218 0.35
219 0.29
220 0.23
221 0.25
222 0.23
223 0.21
224 0.22
225 0.24
226 0.25
227 0.27
228 0.26
229 0.22
230 0.24
231 0.23
232 0.23
233 0.27
234 0.28
235 0.26
236 0.27
237 0.26
238 0.24
239 0.25
240 0.24
241 0.2
242 0.16
243 0.16
244 0.14
245 0.15
246 0.17
247 0.21
248 0.28
249 0.27
250 0.31
251 0.35
252 0.36
253 0.41
254 0.5
255 0.52
256 0.54
257 0.63
258 0.62
259 0.65
260 0.69
261 0.72
262 0.73
263 0.73
264 0.72
265 0.66
266 0.67
267 0.69
268 0.71
269 0.65
270 0.57
271 0.49
272 0.42
273 0.4
274 0.34
275 0.25
276 0.17
277 0.14
278 0.13
279 0.14
280 0.14
281 0.12
282 0.12
283 0.15
284 0.16
285 0.19
286 0.23
287 0.24
288 0.26
289 0.3
290 0.31
291 0.33
292 0.36
293 0.34
294 0.37
295 0.38
296 0.38
297 0.39
298 0.41
299 0.43
300 0.5
301 0.59
302 0.59
303 0.66
304 0.66
305 0.72
306 0.77
307 0.75
308 0.75
309 0.74
310 0.73
311 0.68
312 0.69
313 0.64
314 0.59
315 0.57
316 0.54
317 0.5
318 0.44
319 0.4
320 0.38
321 0.44
322 0.48
323 0.47
324 0.5
325 0.55
326 0.64
327 0.72
328 0.79
329 0.79
330 0.81
331 0.88
332 0.9
333 0.9
334 0.9
335 0.9
336 0.88
337 0.84
338 0.79
339 0.76
340 0.75
341 0.69
342 0.67
343 0.62
344 0.55
345 0.53
346 0.51
347 0.45
348 0.37
349 0.33