Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DHY2

Protein Details
Accession E9DHY2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSVFPSQEPPKKKNKKKKITEINSSRARSHydrophilic
NLS Segment(s)
PositionSequence
10-19PKKKNKKKKI
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MSVFPSQEPPKKKNKKKKITEINSSRARSRFPILWAGMDGWVGRTGGKLLRNNYSPGFIRRLFGADRASPAVQYRKPYLIGGFGVPPVPWHSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.89
4 0.94
5 0.94
6 0.92
7 0.92
8 0.89
9 0.87
10 0.85
11 0.77
12 0.7
13 0.6
14 0.53
15 0.46
16 0.41
17 0.35
18 0.29
19 0.33
20 0.29
21 0.28
22 0.26
23 0.24
24 0.19
25 0.16
26 0.14
27 0.08
28 0.07
29 0.07
30 0.06
31 0.05
32 0.06
33 0.08
34 0.13
35 0.16
36 0.18
37 0.22
38 0.24
39 0.26
40 0.26
41 0.27
42 0.24
43 0.23
44 0.26
45 0.22
46 0.21
47 0.2
48 0.22
49 0.19
50 0.21
51 0.22
52 0.17
53 0.19
54 0.22
55 0.22
56 0.2
57 0.23
58 0.27
59 0.26
60 0.29
61 0.31
62 0.31
63 0.32
64 0.33
65 0.31
66 0.27
67 0.26
68 0.23
69 0.21
70 0.18
71 0.18
72 0.16
73 0.16