Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NNV4

Protein Details
Accession A0A0B7NNV4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-37SKPTSSSGGKKAKKKWSAKKVKDKANNMVIHydrophilic
NLS Segment(s)
PositionSequence
14-31SGGKKAKKKWSAKKVKDK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKDVASKPTSSSGGKKAKKKWSAKKVKDKANNMVILDKPTYDRLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELEAQGLIKPISRHHSQIIYTRATGDEKKPAAAAASEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.54
4 0.57
5 0.62
6 0.69
7 0.75
8 0.81
9 0.82
10 0.83
11 0.87
12 0.89
13 0.92
14 0.9
15 0.91
16 0.89
17 0.85
18 0.82
19 0.78
20 0.71
21 0.6
22 0.55
23 0.45
24 0.38
25 0.32
26 0.24
27 0.18
28 0.18
29 0.19
30 0.17
31 0.16
32 0.18
33 0.2
34 0.19
35 0.26
36 0.28
37 0.28
38 0.31
39 0.32
40 0.29
41 0.31
42 0.31
43 0.23
44 0.19
45 0.18
46 0.16
47 0.17
48 0.17
49 0.13
50 0.13
51 0.14
52 0.14
53 0.12
54 0.12
55 0.1
56 0.11
57 0.11
58 0.12
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1
64 0.1
65 0.09
66 0.09
67 0.08
68 0.09
69 0.09
70 0.1
71 0.09
72 0.1
73 0.11
74 0.13
75 0.19
76 0.21
77 0.24
78 0.26
79 0.31
80 0.31
81 0.38
82 0.4
83 0.38
84 0.35
85 0.33
86 0.31
87 0.31
88 0.32
89 0.28
90 0.32
91 0.3
92 0.31
93 0.3
94 0.28
95 0.26