Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7MRI7

Protein Details
Accession A0A0B7MRI7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
70-92SLSKKLADDKKQKNQSPPKNDADHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 9.333, mito 9, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031632  SVIP  
Pfam View protein in Pfam  
PF15811  SVIP  
Amino Acid Sequences MGNCCGSESQEVESHQIKQIKKSANNSAGQTLGGGASSNIDSEGSREAMLSAAEKRKLQAENRGVKGDGSLSKKLADDKKQKNQSPPKNDADDKLVWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.33
4 0.32
5 0.34
6 0.4
7 0.44
8 0.48
9 0.53
10 0.57
11 0.58
12 0.6
13 0.56
14 0.5
15 0.42
16 0.35
17 0.29
18 0.19
19 0.12
20 0.08
21 0.06
22 0.04
23 0.05
24 0.05
25 0.05
26 0.04
27 0.05
28 0.05
29 0.06
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.09
39 0.11
40 0.13
41 0.13
42 0.14
43 0.18
44 0.22
45 0.23
46 0.3
47 0.36
48 0.42
49 0.45
50 0.46
51 0.42
52 0.38
53 0.36
54 0.3
55 0.27
56 0.24
57 0.23
58 0.22
59 0.23
60 0.24
61 0.31
62 0.35
63 0.39
64 0.44
65 0.52
66 0.62
67 0.71
68 0.76
69 0.8
70 0.83
71 0.84
72 0.83
73 0.81
74 0.78
75 0.76
76 0.73
77 0.66
78 0.61