Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7MQH3

Protein Details
Accession A0A0B7MQH3   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
91-116PPSRSSSLSRPRRFRKTQRDDEIKKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR023394  Sec7_C_sf  
IPR000904  Sec7_dom  
IPR035999  Sec7_dom_sf  
Gene Ontology GO:0005085  F:guanyl-nucleotide exchange factor activity  
GO:0032012  P:regulation of ARF protein signal transduction  
Pfam View protein in Pfam  
PF01369  Sec7  
PROSITE View protein in PROSITE  
PS50190  SEC7  
Amino Acid Sequences MQKEQHQKQQEYQHRNNINKVLPCIQPTLRQESSARNSQLGKLTRSSSLSNLSRKASSRQILWHHKRLDEPLPPIPPFLFEESEAQAVIIPPSRSSSLSRPRRFRKTQRDDEIKKALLEWKHESIFKVDWVNMFPASVELWNMNDNIFGSLEDLIILKEDDEKLVQETANSLWLENEMHAPKKKTAAYIGKLDPFCHRVLKQYMNQFDFTGMKLDEAFRKLCQKLYFKAEAQEIDRILEAFAYKFWSQNPCKQLYQNAGTVLYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.76
4 0.72
5 0.69
6 0.63
7 0.6
8 0.55
9 0.5
10 0.47
11 0.46
12 0.41
13 0.42
14 0.42
15 0.46
16 0.41
17 0.41
18 0.4
19 0.44
20 0.48
21 0.48
22 0.46
23 0.41
24 0.41
25 0.42
26 0.48
27 0.43
28 0.4
29 0.35
30 0.36
31 0.35
32 0.37
33 0.35
34 0.29
35 0.33
36 0.36
37 0.38
38 0.39
39 0.39
40 0.39
41 0.4
42 0.42
43 0.42
44 0.39
45 0.37
46 0.4
47 0.47
48 0.55
49 0.6
50 0.64
51 0.59
52 0.58
53 0.58
54 0.56
55 0.53
56 0.48
57 0.45
58 0.42
59 0.43
60 0.41
61 0.39
62 0.34
63 0.29
64 0.26
65 0.24
66 0.2
67 0.16
68 0.18
69 0.19
70 0.19
71 0.17
72 0.14
73 0.11
74 0.1
75 0.1
76 0.1
77 0.09
78 0.09
79 0.11
80 0.13
81 0.14
82 0.17
83 0.25
84 0.32
85 0.42
86 0.5
87 0.57
88 0.64
89 0.72
90 0.78
91 0.8
92 0.81
93 0.81
94 0.84
95 0.84
96 0.87
97 0.81
98 0.79
99 0.74
100 0.63
101 0.53
102 0.43
103 0.38
104 0.29
105 0.3
106 0.27
107 0.24
108 0.25
109 0.26
110 0.25
111 0.23
112 0.22
113 0.19
114 0.17
115 0.14
116 0.13
117 0.13
118 0.14
119 0.11
120 0.1
121 0.08
122 0.07
123 0.07
124 0.06
125 0.06
126 0.05
127 0.05
128 0.06
129 0.07
130 0.06
131 0.06
132 0.06
133 0.07
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.04
145 0.05
146 0.06
147 0.06
148 0.06
149 0.07
150 0.08
151 0.09
152 0.09
153 0.07
154 0.08
155 0.08
156 0.12
157 0.12
158 0.1
159 0.09
160 0.1
161 0.11
162 0.1
163 0.15
164 0.12
165 0.17
166 0.21
167 0.24
168 0.25
169 0.3
170 0.31
171 0.29
172 0.35
173 0.39
174 0.39
175 0.43
176 0.45
177 0.45
178 0.44
179 0.43
180 0.39
181 0.33
182 0.31
183 0.29
184 0.27
185 0.27
186 0.33
187 0.39
188 0.41
189 0.47
190 0.53
191 0.5
192 0.51
193 0.44
194 0.4
195 0.34
196 0.29
197 0.24
198 0.16
199 0.14
200 0.14
201 0.16
202 0.18
203 0.2
204 0.21
205 0.2
206 0.27
207 0.28
208 0.33
209 0.38
210 0.4
211 0.43
212 0.49
213 0.52
214 0.47
215 0.5
216 0.48
217 0.45
218 0.42
219 0.4
220 0.33
221 0.28
222 0.26
223 0.22
224 0.18
225 0.15
226 0.13
227 0.09
228 0.09
229 0.14
230 0.14
231 0.15
232 0.19
233 0.28
234 0.32
235 0.4
236 0.47
237 0.47
238 0.51
239 0.54
240 0.58
241 0.57
242 0.56
243 0.52
244 0.48