Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NX61

Protein Details
Accession A0A0B7NX61    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
125-151TGRIRLKKFYQKHCSRHKTKLNRRSVVHydrophilic
NLS Segment(s)
PositionSequence
120-132QRRRVTGRIRLKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHEAPPVSIHYETIRDGQSRLFLLNKKIHNQPVIYTQPVQKNALSIHAATAIQGIDPGLVTMASGIYTSPITLINSIKRYQGAPQSAEDDKTNTFKLTARFIDKACLKQYNIHSNHKRVQRRRVTGRIRLKKFYQKHCSRHKTKLNRRSVVTFVGNWSGVSKFVEGHERRSTGPYYRQLSAPKNGHLVVVDEFASTITCNSCFSRNQKQFCRLPNGKIRRVPGAVYCINPQCLRRLNSNAITTKRDRNGAMNIALVGFCSLIFEDGHLLPPFQRLYNSNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.24
4 0.24
5 0.26
6 0.24
7 0.25
8 0.26
9 0.26
10 0.33
11 0.4
12 0.43
13 0.45
14 0.51
15 0.55
16 0.54
17 0.51
18 0.46
19 0.48
20 0.47
21 0.45
22 0.42
23 0.42
24 0.44
25 0.46
26 0.46
27 0.38
28 0.36
29 0.33
30 0.34
31 0.29
32 0.22
33 0.2
34 0.19
35 0.19
36 0.15
37 0.16
38 0.11
39 0.09
40 0.09
41 0.08
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.05
57 0.07
58 0.07
59 0.09
60 0.12
61 0.16
62 0.2
63 0.21
64 0.22
65 0.22
66 0.22
67 0.25
68 0.3
69 0.29
70 0.28
71 0.28
72 0.31
73 0.31
74 0.31
75 0.27
76 0.22
77 0.19
78 0.2
79 0.19
80 0.15
81 0.15
82 0.17
83 0.19
84 0.22
85 0.24
86 0.25
87 0.27
88 0.27
89 0.33
90 0.32
91 0.34
92 0.32
93 0.32
94 0.29
95 0.33
96 0.38
97 0.42
98 0.44
99 0.51
100 0.53
101 0.54
102 0.6
103 0.62
104 0.66
105 0.62
106 0.68
107 0.67
108 0.71
109 0.73
110 0.77
111 0.76
112 0.76
113 0.8
114 0.79
115 0.74
116 0.7
117 0.66
118 0.66
119 0.66
120 0.66
121 0.66
122 0.65
123 0.7
124 0.77
125 0.81
126 0.78
127 0.8
128 0.8
129 0.8
130 0.81
131 0.83
132 0.82
133 0.77
134 0.73
135 0.66
136 0.59
137 0.52
138 0.43
139 0.33
140 0.24
141 0.21
142 0.19
143 0.15
144 0.14
145 0.1
146 0.09
147 0.09
148 0.08
149 0.07
150 0.08
151 0.18
152 0.18
153 0.23
154 0.26
155 0.27
156 0.28
157 0.3
158 0.31
159 0.26
160 0.32
161 0.34
162 0.34
163 0.34
164 0.36
165 0.39
166 0.41
167 0.45
168 0.42
169 0.36
170 0.35
171 0.34
172 0.31
173 0.26
174 0.23
175 0.16
176 0.14
177 0.12
178 0.09
179 0.09
180 0.09
181 0.08
182 0.07
183 0.06
184 0.06
185 0.06
186 0.08
187 0.1
188 0.13
189 0.18
190 0.24
191 0.35
192 0.42
193 0.5
194 0.56
195 0.63
196 0.66
197 0.68
198 0.72
199 0.65
200 0.65
201 0.67
202 0.68
203 0.68
204 0.67
205 0.63
206 0.59
207 0.56
208 0.51
209 0.44
210 0.42
211 0.37
212 0.34
213 0.35
214 0.32
215 0.33
216 0.34
217 0.31
218 0.31
219 0.36
220 0.37
221 0.39
222 0.43
223 0.47
224 0.51
225 0.57
226 0.57
227 0.54
228 0.57
229 0.55
230 0.56
231 0.53
232 0.51
233 0.46
234 0.44
235 0.47
236 0.46
237 0.43
238 0.35
239 0.31
240 0.27
241 0.25
242 0.2
243 0.13
244 0.08
245 0.06
246 0.06
247 0.06
248 0.07
249 0.07
250 0.07
251 0.11
252 0.11
253 0.16
254 0.16
255 0.16
256 0.16
257 0.21
258 0.22
259 0.2
260 0.24