Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D6L4

Protein Details
Accession E9D6L4   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-92SIALAAQGKKKKKKKRGLQVIQQLHPPHydrophilic
NLS Segment(s)
PositionSequence
73-82GKKKKKKKRG
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MELARRCHTLSIEPQKGRISTQLDHKGQNQSVVRHPVGRSQKTPSAVIVVSLRDFSQTSMAASRSSIALAAQGKKKKKKKRGLQVIQQLHPPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.5
4 0.46
5 0.41
6 0.36
7 0.29
8 0.38
9 0.45
10 0.43
11 0.46
12 0.48
13 0.49
14 0.44
15 0.48
16 0.41
17 0.35
18 0.38
19 0.41
20 0.37
21 0.34
22 0.34
23 0.35
24 0.4
25 0.41
26 0.38
27 0.38
28 0.41
29 0.39
30 0.4
31 0.32
32 0.26
33 0.22
34 0.2
35 0.16
36 0.12
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.08
43 0.09
44 0.08
45 0.09
46 0.11
47 0.11
48 0.11
49 0.1
50 0.11
51 0.09
52 0.08
53 0.08
54 0.06
55 0.09
56 0.12
57 0.17
58 0.24
59 0.3
60 0.39
61 0.49
62 0.59
63 0.67
64 0.74
65 0.8
66 0.84
67 0.89
68 0.91
69 0.92
70 0.93
71 0.93
72 0.91
73 0.83
74 0.77