Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N503

Protein Details
Accession A0A0B7N503    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
59-82MELIKNSKDKRARKLCKSKLGSFLHydrophilic
NLS Segment(s)
PositionSequence
66-87KDKRARKLCKSKLGSFLRAKKK
Subcellular Location(s) mito 18.5, cyto_mito 12, cyto 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MVASKSGIAVGLNKGHITARRELKTKPSNKIGAASKRTVFVKSIIREVAGYAPYERRLMELIKNSKDKRARKLCKSKLGSFLRAKKKVEELQGVIAASRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.23
4 0.24
5 0.29
6 0.35
7 0.39
8 0.42
9 0.43
10 0.51
11 0.56
12 0.59
13 0.58
14 0.57
15 0.56
16 0.54
17 0.59
18 0.56
19 0.55
20 0.53
21 0.49
22 0.42
23 0.41
24 0.41
25 0.36
26 0.29
27 0.24
28 0.26
29 0.24
30 0.26
31 0.23
32 0.22
33 0.21
34 0.2
35 0.18
36 0.12
37 0.11
38 0.09
39 0.1
40 0.11
41 0.11
42 0.11
43 0.09
44 0.1
45 0.12
46 0.15
47 0.22
48 0.27
49 0.32
50 0.39
51 0.39
52 0.45
53 0.52
54 0.54
55 0.57
56 0.62
57 0.66
58 0.7
59 0.8
60 0.82
61 0.84
62 0.85
63 0.8
64 0.79
65 0.76
66 0.74
67 0.72
68 0.73
69 0.73
70 0.72
71 0.69
72 0.63
73 0.65
74 0.63
75 0.61
76 0.59
77 0.51
78 0.49
79 0.5
80 0.45
81 0.37