Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N431

Protein Details
Accession A0A0B7N431   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-88LPSEQPISRAKCKKKAKSKRNLDTILSHydrophilic
NLS Segment(s)
PositionSequence
74-80KKKAKSK
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MSQIQVFAASISNNSNSNGTRNNAAIAAAIFIFPTPIQVPTISPVRPASAIVAPMPLPRSFLPSEQPISRAKCKKKAKSKRNLDTILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.16
4 0.19
5 0.22
6 0.22
7 0.23
8 0.22
9 0.22
10 0.19
11 0.18
12 0.15
13 0.11
14 0.1
15 0.07
16 0.06
17 0.05
18 0.05
19 0.05
20 0.04
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.08
27 0.1
28 0.14
29 0.12
30 0.13
31 0.13
32 0.13
33 0.13
34 0.13
35 0.12
36 0.1
37 0.11
38 0.1
39 0.1
40 0.09
41 0.1
42 0.12
43 0.1
44 0.12
45 0.11
46 0.16
47 0.17
48 0.18
49 0.21
50 0.23
51 0.28
52 0.26
53 0.28
54 0.29
55 0.34
56 0.42
57 0.48
58 0.51
59 0.58
60 0.67
61 0.75
62 0.81
63 0.86
64 0.87
65 0.89
66 0.92
67 0.93
68 0.92